BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG19   Members:13             3pri:Y   1e-109     
AAM93676.1       unknown protein [Oryza sativa (japonica
cultivar-group)] gb|AAP54468.1| unknown protein [Oryza sativa (japonic
         (1226 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9638.m03160|protein  expressed protein                          477  e-134
 9635.m04698|protein  Zinc finger, C3HC4 type (RING finger)...   359  7e-99
 9638.m02656|protein  expressed protein                          284  3e-76
 9632.m05700|protein  expressed protein                          206  8e-53
 9632.m05699|protein  expressed protein                          206  8e-53
 9635.m01750|protein  hypothetical protein                       198  2e-50

  9638.m03160|protein  expressed protein
           Length = 242
           
 Score =  477 bits (1214), Expect = e-134
 Identities = 225/242 (92%), Positives = 234/242 (95%)
 Frame = +2

Query: 209 MRKAYRDSLKVLEADIQHANTLATEFPREYDGACLQMRLSFSPAAHIFLFLVQWTDCSLA 388
           MRKAY+DS KVLEADIQHANTLA+EFPREYDGACLQMRLS+SPAAHIFLFLVQWTDCSLA
Sbjct: 1   MRKAYKDSFKVLEADIQHANTLASEFPREYDGACLQMRLSYSPAAHIFLFLVQWTDCSLA 60

Query: 389 GALGLMRILIYKVYVDGTTTMSTHERKASIKEFYAVIFPSLLQLQRGITDMEDKKQKAVC 568
           GALGL+RIL+YKVYVDGTTTMSTHERKASIKEFYAVIFPSLLQLQRGITD EDKKQKAVC
Sbjct: 61  GALGLLRILVYKVYVDGTTTMSTHERKASIKEFYAVIFPSLLQLQRGITDTEDKKQKAVC 120

Query: 569 MERYRRRDEDEATSLSDVDAEREEECGICMEMNSKVVLPNCTHAMCLRCYQDWNSRSQSC 748
           MERYRRRDEDE   LS++DAEREEECGICMEMNSKVVLPNCTH MCLRCYQDWNSRSQSC
Sbjct: 121 MERYRRRDEDERNILSEIDAEREEECGICMEMNSKVVLPNCTHNMCLRCYQDWNSRSQSC 180

Query: 749 PFCRDNLNKTDPGDLWIYVEDDDVVDMETVSRENLRRLFMYINKLPLIVPDVIFSVYDSH 928
           PFCRDNL KTDPGDLWIYVED DVVD+ETVSRENLRRLFMYINKLPLIVPDVIFS+YDSH
Sbjct: 181 PFCRDNLKKTDPGDLWIYVEDQDVVDLETVSRENLRRLFMYINKLPLIVPDVIFSIYDSH 240

Query: 929 IK 934
           IK
Sbjct: 241 IK 242
  9635.m04698|protein  Zinc finger, C3HC4 type (RING finger),
           putative
           Length = 268
           
 Score =  359 bits (911), Expect = 7e-99
 Identities = 167/226 (73%), Positives = 199/226 (87%), Gaps = 20/226 (8%)
 Frame = +2

Query: 209 MRKAYRDSLKVLEADIQHANTL--------------------ATEFPREYDGACLQMRLS 328
           M +++RDSLKVLEADIQHAN+L                    A EF REYDGACLQMR+S
Sbjct: 1   MGRSFRDSLKVLEADIQHANSLDTCHQIYCLSGQSYLLWPCSAAEFRREYDGACLQMRMS 60

Query: 329 FSPAAHIFLFLVQWTDCSLAGALGLMRILIYKVYVDGTTTMSTHERKASIKEFYAVIFPS 508
           + PAAH FLFLVQWTDC+LAGALGL+RILIYKVY DGTTTMS HERKASI+EFYAVIFPS
Sbjct: 61  YCPAAHFFLFLVQWTDCNLAGALGLLRILIYKVYADGTTTMSAHERKASIREFYAVIFPS 120

Query: 509 LLQLQRGITDMEDKKQKAVCMERYRRRDEDEATSLSDVDAEREEECGICMEMNSKVVLPN 688
           L+QL  GI ++EDKKQKA+C+ERYRRRDED+   +S++D   EEECGICME+N KVVLP 
Sbjct: 121 LMQLHEGINEVEDKKQKAICIERYRRRDEDQKMVISEIDDNIEEECGICMEINGKVVLPT 180

Query: 689 CTHAMCLRCYQDWNSRSQSCPFCRDNLNKTDPGDLWIYVEDDDVVDMETVSRENLRRLFM 868
           C+HAMC++CY+DW SRSQSCPFCRD+L + +  DLWIY ++ D+VD+ TV +ENLRRLFM
Sbjct: 181 CSHAMCIKCYRDWRSRSQSCPFCRDSLKRVNSADLWIYTDNRDIVDIATVRKENLRRLFM 240

Query: 869 YINKLP 886
           YI+KLP
Sbjct: 241 YIDKLP 246
  9638.m02656|protein  expressed protein
           Length = 246
           
 Score =  284 bits (718), Expect = 3e-76
 Identities = 126/220 (57%), Positives = 179/220 (81%), Gaps = 1/220 (0%)
 Frame = +2

Query: 275 ATEFPREYDGACLQMRLSFSPAAHIFLFLVQWTDCSLAGALGLMRILIYKVYVDGTTTMS 454
           A+EF R+YDGA +QMR+++S  AH   FLVQW DC LAGALGL++I+IYKVY DGTT + 
Sbjct: 33  ASEFLRDYDGAVIQMRMAYSAVAH---FLVQWIDCKLAGALGLLKIMIYKVYADGTTALP 89

Query: 455 THERKASIKEFYAVIFPSLLQLQRGITDMEDKKQKAVCMERYRRRDEDEATSLSDVDAER 634
             ER+ASI++FY VIFPSLLQL  GIT+++D+KQ+ +C++++R+ +E     +S+VD ER
Sbjct: 90  EWEREASIRQFYGVIFPSLLQLPSGITELDDRKQRRLCLQKFRKVEE----RVSEVDLER 145

Query: 635 EEECGICMEMNSKVVLPNCTHAMCLRCYQDWNSRSQSCPFCRDNLNKTDPGDLWIYVEDD 814
           E ECGIC+E+N+K+VLP+C H++C+RC++DWN++S+SCPFCR  L K +P  LW+Y +D 
Sbjct: 146 ELECGICLEVNAKIVLPDCAHSLCMRCFEDWNTKSKSCPFCRACLKKVNPSSLWLYTDDR 205

Query: 815 DVVDMETVSRENLRRLFMYINKLPLIVPDVI-FSVYDSHIK 934
           DVVDM+T++REN+RRLFM+I+KLPL+V  V+   +Y+  IK
Sbjct: 206 DVVDMDTLTRENIRRLFMFISKLPLVVLHVVDLDIYEYRIK 246
  9632.m05700|protein  expressed protein
           Length = 157
           
 Score =  206 bits (518), Expect = 8e-53
 Identities = 95/117 (81%), Positives = 113/117 (96%)
 Frame = +2

Query: 209 MRKAYRDSLKVLEADIQHANTLATEFPREYDGACLQMRLSFSPAAHIFLFLVQWTDCSLA 388
           MRK+++DSLKVLEADIQHANTLA++F R+YDGACLQMR+S+SPAA  FLFLVQWTDCSLA
Sbjct: 6   MRKSFKDSLKVLEADIQHANTLASDFSRDYDGACLQMRMSYSPAAQFFLFLVQWTDCSLA 65

Query: 389 GALGLMRILIYKVYVDGTTTMSTHERKASIKEFYAVIFPSLLQLQRGITDMEDKKQK 559
           GALGL+RILIYKVYVDGTTT+STHERKASI+EFYAVIFPSL+QL +GI+D++D++QK
Sbjct: 66  GALGLLRILIYKVYVDGTTTLSTHERKASIREFYAVIFPSLMQLHKGISDVDDRRQK 122
  9632.m05699|protein  expressed protein
           Length = 157
           
 Score =  206 bits (518), Expect = 8e-53
 Identities = 95/117 (81%), Positives = 113/117 (96%)
 Frame = +2

Query: 209 MRKAYRDSLKVLEADIQHANTLATEFPREYDGACLQMRLSFSPAAHIFLFLVQWTDCSLA 388
           MRK+++DSLKVLEADIQHANTLA++F R+YDGACLQMR+S+SPAA  FLFLVQWTDCSLA
Sbjct: 6   MRKSFKDSLKVLEADIQHANTLASDFSRDYDGACLQMRMSYSPAAQFFLFLVQWTDCSLA 65

Query: 389 GALGLMRILIYKVYVDGTTTMSTHERKASIKEFYAVIFPSLLQLQRGITDMEDKKQK 559
           GALGL+RILIYKVYVDGTTT+STHERKASI+EFYAVIFPSL+QL +GI+D++D++QK
Sbjct: 66  GALGLLRILIYKVYVDGTTTLSTHERKASIREFYAVIFPSLMQLHKGISDVDDRRQK 122
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83969255 Number of Sequences: 59712 Number of extensions: 2598395 Number of successful extensions: 28050 Number of sequences better than 1.0e-10: 12 Number of HSP's better than 0.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 28039 Number of HSP's gapped (non-prelim): 6 length of query: 408 length of database: 26,991,925 effective HSP length: 51 effective length of query: 357 effective length of database: 23,946,613 effective search space: 8548940841 effective search space used: 8548940841 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG44   Members:6              3pri:Y   7e-35      
NP_187864.1      heat shock protein hsp70 [Arabidopsis thaliana]
dbj|BAB02269.1| 70 kDa heat shock protein [Arabidopsis thalian
         (618 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9631.m01656|protein  heat shock cognate 70 kda protein          224  8e-59
 9629.m06146|protein  dnaK protein                               187  2e-47
 9639.m04468|protein  dnaK-type molecular chaperone hsp70 -...   184  1e-46
 9639.m04467|protein  dnaK-type molecular chaperone hsp70 -...   184  1e-46
 9631.m01647|protein  dnaK protein                               183  2e-46
 9631.m05972|protein  heat shock protein cognate 70              182  5e-46
 9633.m03577|protein  dnaK protein                               180  2e-45
 9633.m03578|protein  dnaK protein                               180  2e-45
 9630.m00144|protein  dnaK-type molecular chaperone BiP - rice   116  4e-26
 9631.m04907|protein  putative luminal binding protein           102  6e-22
 9633.m03294|protein  luminal binding protein 5 precursor (...    96  4e-20
 9636.m04621|protein  BiP-isoform D                               90  3e-18
 9633.m02768|protein  luminal binding protein 4 precursor (...    88  1e-17

  9631.m01656|protein  heat shock cognate 70 kda protein
           Length = 653
           
 Score =  224 bits (566), Expect = 8e-59
 Identities = 110/120 (91%), Positives = 113/120 (93%)
 Frame = -2

Query: 617 EDEQVRHKVEARNALENYAYNMRNTVRDEKIASKLPDDDKKKIEDSIEDAIKWLDGNQLA 438
           EDEQVRHKVEARNALENYAYNMRNTVRDEKIASKLP DDKKKIED+IEDAIKWLDGNQLA
Sbjct: 535 EDEQVRHKVEARNALENYAYNMRNTVRDEKIASKLPADDKKKIEDAIEDAIKWLDGNQLA 594

Query: 437 EADEFEDKMKELESICNPIISKMYQGAGPGGAAGMDEDMPSGGAGAGGGSGAGPKIEEVD 258
           EADEFEDKMKELES+CNPIISKMYQG G GG AGMDED P+G AG GGGSGAGPKIEEVD
Sbjct: 595 EADEFEDKMKELESLCNPIISKMYQG-GAGGPAGMDEDAPNGSAGTGGGSGAGPKIEEVD 653
  9629.m06146|protein  dnaK protein
           Length = 648
           
 Score =  187 bits (470), Expect = 2e-47
 Identities = 94/120 (78%), Positives = 105/120 (87%), Gaps = 2/120 (1%)
 Frame = -2

Query: 617 EDEQVRHKVEARNALENYAYNMRNTVRDEKIASKLPDDDKKKIEDSIEDAIKWLDGNQLA 438
           EDE+ + KV+A+NALENYAYNMRNT++D+KIASKL  DDKKKIED+I+ AI WLD NQLA
Sbjct: 533 EDEEHKKKVDAKNALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIDGAINWLDSNQLA 592

Query: 437 EADEFEDKMKELESICNPIISKMYQGAGP--GGAAGMDEDMPSGGAGAGGGSGAGPKIEE 264
           EADEFEDKMKELESICNPII+KMYQGAG   GGAAGMDED P+      GGSGAGPKIEE
Sbjct: 593 EADEFEDKMKELESICNPIIAKMYQGAGADMGGAAGMDEDAPA------GGSGAGPKIEE 646

Query: 263 VD 258
           VD
Sbjct: 647 VD 648
  9639.m04468|protein  dnaK-type molecular chaperone hsp70 - rice
           (fragment)
           Length = 602
           
 Score =  184 bits (462), Expect = 1e-46
 Identities = 91/120 (75%), Positives = 102/120 (84%)
 Frame = -2

Query: 617 EDEQVRHKVEARNALENYAYNMRNTVRDEKIASKLPDDDKKKIEDSIEDAIKWLDGNQLA 438
           EDE+ + KVE++NALENYAYNMRNT++DEKIASKLP  DKKKIED+I+ AI+WLDGNQLA
Sbjct: 487 EDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLA 546

Query: 437 EADEFEDKMKELESICNPIISKMYQGAGPGGAAGMDEDMPSGGAGAGGGSGAGPKIEEVD 258
           EADEF+DKMKELE ICNPII+KMYQGAG   A GMDED     A   GGSGAGPKIEEVD
Sbjct: 547 EADEFDDKMKELEGICNPIIAKMYQGAGADMAGGMDED----DAPPAGGSGAGPKIEEVD 602
  9639.m04467|protein  dnaK-type molecular chaperone hsp70 - rice
           (fragment)
           Length = 649
           
 Score =  184 bits (462), Expect = 1e-46
 Identities = 91/120 (75%), Positives = 102/120 (84%)
 Frame = -2

Query: 617 EDEQVRHKVEARNALENYAYNMRNTVRDEKIASKLPDDDKKKIEDSIEDAIKWLDGNQLA 438
           EDE+ + KVE++NALENYAYNMRNT++DEKIASKLP  DKKKIED+I+ AI+WLDGNQLA
Sbjct: 534 EDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLA 593

Query: 437 EADEFEDKMKELESICNPIISKMYQGAGPGGAAGMDEDMPSGGAGAGGGSGAGPKIEEVD 258
           EADEF+DKMKELE ICNPII+KMYQGAG   A GMDED     A   GGSGAGPKIEEVD
Sbjct: 594 EADEFDDKMKELEGICNPIIAKMYQGAGADMAGGMDED----DAPPAGGSGAGPKIEEVD 649
  9631.m01647|protein  dnaK protein
           Length = 650
           
 Score =  183 bits (460), Expect = 2e-46
 Identities = 88/120 (73%), Positives = 102/120 (84%)
 Frame = -2

Query: 617 EDEQVRHKVEARNALENYAYNMRNTVRDEKIASKLPDDDKKKIEDSIEDAIKWLDGNQLA 438
           EDE+ + KV+A+N+LENYAYNMRNT++D+KIASKLP+ DKKKIED+I+ AI WLD NQLA
Sbjct: 534 EDEEHKKKVDAKNSLENYAYNMRNTIKDDKIASKLPEADKKKIEDAIDGAISWLDSNQLA 593

Query: 437 EADEFEDKMKELESICNPIISKMYQGAGPGGAAGMDEDMPSGGAGAGGGSGAGPKIEEVD 258
           EA+EFEDKMKELE +CNPII+KMYQGAG   A GMDED P   A AGG SG GPKIEEVD
Sbjct: 594 EAEEFEDKMKELEGVCNPIIAKMYQGAGADMAGGMDEDAP---AAAGGSSGPGPKIEEVD 650
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42535181 Number of Sequences: 59712 Number of extensions: 1446129 Number of successful extensions: 38569 Number of sequences better than 1.0e-10: 26 Number of HSP's better than 0.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 38536 Number of HSP's gapped (non-prelim): 17 length of query: 206 length of database: 26,991,925 effective HSP length: 49 effective length of query: 156 effective length of database: 24,066,037 effective search space: 3754301772 effective search space used: 3754301772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 156 (65.2 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG57   Members:7              3pri:Y                
                
         (1083 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9636.m00068|protein  transposon protein, putative, CACTA, ...    90  6e-18
 9634.m04025|protein  transposon protein, putative, CACTA, ...    87  4e-17
 9635.m04045|protein  transposon protein, putative, CACTA, ...    87  5e-17
 9634.m00264|protein  transposon protein, putative, CACTA, ...    84  4e-16
 9640.m04219|protein  retrotransposon protein, putative, Ty...    84  5e-16
 9637.m02751|protein  expressed protein                           81  4e-15
 9630.m04955|protein  transposon protein, putative, CACTA, ...    81  4e-15
 9632.m05090|protein  Piwi domain, putative                       81  4e-15
 9630.m01457|protein  transposon protein, putative, mariner...    81  4e-15
 9629.m00785|protein  transposon protein, putative, CACTA, ...    80  7e-15
 9637.m02750|protein  expressed protein                           78  3e-14
 9635.m04942|protein  transposon protein, putative, CACTA, ...    76  8e-14
 9640.m01076|protein  transposon protein, putative, CACTA, ...    76  8e-14
 9635.m04941|protein  transposon protein, putative, CACTA, ...    76  8e-14
 9635.m04943|protein  transposon protein, putative, CACTA, ...    76  1e-13
 9634.m00654|protein  transposon protein, putative, CACTA, ...    76  1e-13
 9631.m01941|protein  retrotransposon protein, putative, Ty...    76  1e-13
 9635.m03215|protein  transposon protein, putative, CACTA, ...    76  1e-13
 9635.m03216|protein  transposon protein, putative, CACTA, ...    75  2e-13
 9634.m00954|protein  transposon protein, putative, CACTA, ...    75  2e-13

  9636.m00068|protein  transposon protein, putative, CACTA, En/Spm
           sub-class
           Length = 342
           
 Score = 90.1 bits (220), Expect = 6e-18
 Identities = 53/105 (50%), Positives = 59/105 (55%), Gaps = 12/105 (11%)
 Frame = -3

Query: 715 PPL--PRPRAHPPLQPALPRPLP--RPPWSPSR----PRLAPRPPARPQLLARAPWPPPS 560
           PP+  PRP+A PP Q   P P P  RPP  P R    P  AP PP++         PPP 
Sbjct: 34  PPVMPPRPQAPPPPQRFPPPPAPPIRPPSPPGRAPPPPGRAPPPPSQA--------PPPP 85

Query: 559 RRRPAPPPWPPRPRRGQAPRPR----PPPARGPPPSSRPPRRPRASPPPAPPPSARP 401
           RR P PP  PP P R   P P     PPP R PPP + PP  PR +PPP  PP   P
Sbjct: 86  RRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPP 142
 Score = 89.3 bits (218), Expect = 1e-17
 Identities = 58/118 (49%), Positives = 60/118 (50%), Gaps = 9/118 (7%)
 Frame = -3

Query: 721 RWPPLPRPRAHPPLQPALPRPLPR-----PPWSPSRPRLAPRPPARPQLLARAPWPPPSR 557
           R+PP P P   PP  P    P P      P  +P  PR AP PPA P        PPP R
Sbjct: 49  RFPPPPAPPIRPPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPPPALP--------PPPPR 100

Query: 556 RRPAPP--PWPPRPRRGQAP--RPRPPPARGPPPSSRPPRRPRASPPPAPPPSARPSGSG 389
           R P PP  P PP PRR   P   P PPP R PPP S P R P   PPP P P A P  S 
Sbjct: 101 RAPPPPSMPPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPP---PPPTPRPYAPPPPS- 156

Query: 388 HQRWPLP 368
           H   P P
Sbjct: 157 HPLAPPP 163
 Score = 88.9 bits (217), Expect = 1e-17
 Identities = 54/102 (52%), Positives = 59/102 (56%), Gaps = 10/102 (9%)
 Frame = -3

Query: 718 WPPLPRPRAHPPLQPALPRP--LPRPPWSPSRPRLAPRPPARP----QLLARAPWPPPSR 557
           +PP P P A  PL P  P+P  +P  P +P  P+  P PPA P        RAP PPP R
Sbjct: 17  YPPNPNPYA--PLNPNAPKPPVMPPRPQAPPPPQRFPPPPAPPIRPPSPPGRAP-PPPGR 73

Query: 556 RRPAPPPWPPRPRRGQAP--RPRPPPARGPPPSSRPPRRP--RASPPPAPPP 413
             P P   PP PRR   P   P PPP R PPP S PP  P  RA PPPA PP
Sbjct: 74  APPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAPPPPATPP 125
  9634.m04025|protein  transposon protein, putative, CACTA, En/Spm
           sub-class
           Length = 321
           
 Score = 87.4 bits (213), Expect = 4e-17
 Identities = 51/100 (51%), Positives = 52/100 (52%), Gaps = 1/100 (1%)
 Frame = +3

Query: 414 GGGAGGGDARGRRGGREDGGGPRAGGGRGRGACPRRGRGGQGGGAGRRRDGGGQGARASS 593
           GGG GGG   G  GG   GGG   GGG G G     GRGG GGG G    GGG G     
Sbjct: 84  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG---- 139

Query: 594 CGRAGGRGASRGRDGDQGGRGR-GRGSAGCSGGCARGRGRG 713
            G  GG G + G DGD G  G  G G AG  GG  RGRGRG
Sbjct: 140 -GGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGGKGRGRGRG 179
 Score = 84.3 bits (205), Expect = 4e-16
 Identities = 49/107 (45%), Positives = 52/107 (47%), Gaps = 2/107 (1%)
 Frame = +3

Query: 402 GRADGGGAGGGDARGRRGGREDGGGPRAGGGRGRGACPRRGRGGQGGGAGRRRDGGGQGA 581
           G   GGG GGG   G  GG   GGG   GGG GRG     G GG GGG G    GGG G 
Sbjct: 88  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 147

Query: 582 RASSCGRAGGRGASRGRD-GDQGGRGRGRG-SAGCSGGCARGRGRGGHR 722
                G  G  G     D G +GG+GRGRG   G   G  RG G+ G R
Sbjct: 148 NGGDDGDNGDDGEDGDGDAGGRGGKGRGRGRGRGMGSGIGRGNGQNGDR 196
 Score = 72.6 bits (175), Expect = 1e-12
 Identities = 49/105 (46%), Positives = 56/105 (52%), Gaps = 25/105 (23%)
 Frame = +3

Query: 402 GRADGGGAGGGDARGRRGGREDGGGPRAGGGRGRGACPRRGRGGQGGGAGRRRDGGGQGA 581
           G   GGG GGG   G  GG   GGG R GGG G G     G GG GGG G   +GG  G 
Sbjct: 95  GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGD 154

Query: 582 RASS-------CGRAGGRGASRGR--------------DGDQ----GGRGRGRGSAGCSG 686
                       G  GG+G  RGR              +GD+    GGRG+ +GS G S 
Sbjct: 155 NGDDGEDGDGDAGGRGGKGRGRGRGRGMGSGIGRGNGQNGDRGINSGGRGKIKGSNGGSR 214

Query: 687 GCARGRGRGG 716
               G  +GG
Sbjct: 215 NVIGGGNKGG 224
  9635.m04045|protein  transposon protein, putative, CACTA, En/Spm
           sub-class
           Length = 741
           
 Score = 87.0 bits (212), Expect = 5e-17
 Identities = 51/105 (48%), Positives = 54/105 (50%), Gaps = 5/105 (4%)
 Frame = -3

Query: 715 PPLPRPRAHPPLQPALPRPLPRPPWSPSRPRLAPRPPARPQLLARAPWPPPSR-----RR 551
           PP P P   PPL  ++P P P PP S S    AP PP  P     AP PPP         
Sbjct: 89  PPPPPP---PPLLRSVPPPPPPPPISHSN---APPPPPLPAARFNAPPPPPPPPTTHFNA 142

Query: 550 PAPPPWPPRPRRGQAPRPRPPPARGPPPSSRPPRRPRASPPPAPPPSARP 401
           P PPP PP  R G  P P PPP+  PPP   PP      PPP PPP ARP
Sbjct: 143 PPPPPPPPITRSGAPPSPPPPPS--PPPPPPPPGARPGPPPPPPPPGARP 190
 Score = 87.0 bits (212), Expect = 5e-17
 Identities = 55/115 (47%), Positives = 58/115 (49%), Gaps = 11/115 (9%)
 Frame = -3

Query: 733 LTRSRWPPLPRPRAHPPLQP----ALPRPLPRPPWSPSRPRLAPRPPARPQLLARAPWPP 566
           +TRS  PP P P   PP  P    A P P P PP   +RP   P PP      +  P PP
Sbjct: 151 ITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLPP 210

Query: 565 PSRRRPAPPPWPPRPRRGQAPRPRPPP---ARGPPPSSRPPRRPRASPPPAPPPSAR--- 404
           P  R  APPP PP   R  AP P PPP    R PPP   P  R    PPP PPP  R   
Sbjct: 211 PGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGR-LGGPPPPPPPGGRAPP 269

Query: 403 -PSGSG 389
            P G G
Sbjct: 270 PPRGPG 275
 Score = 83.9 bits (204), Expect = 5e-16
 Identities = 53/106 (50%), Positives = 55/106 (51%), Gaps = 10/106 (9%)
 Frame = -3

Query: 715 PPLPRPRAHPPLQPALPRPLPRPPWSP--SRPRLAPRPPARPQLLARAPWPPPSRRRPAP 542
           PP  RP   PP  P   RP P PP  P   RP   P PP   +  A  P PPPS R  AP
Sbjct: 172 PPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAP 231

Query: 541 PPWPPRPRRGQAPRPRPPPA---RGPPPSSRPPRRPRASPPP-----APPPSARPS 398
           PP PP    G+AP P P P     GPPP   PP   RA PPP      PPP   PS
Sbjct: 232 PPPPPPGAGGRAPPPPPAPGGRLGGPPPP--PPPGGRAPPPPRGPGAPPPPGGNPS 285
 Score = 81.9 bits (199), Expect = 2e-15
 Identities = 52/116 (44%), Positives = 59/116 (50%), Gaps = 16/116 (13%)
 Frame = -3

Query: 715 PPLPRPRAHPPLQPALP------RPLPRPPWSPSRPRLAPRPPARPQLLARAPWPPPSRR 554
           PPLP  R + P  P  P       P P PP   +R    P PP  P   +  P PPP   
Sbjct: 119 PPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPP---SPPPPPPPPGA 175

Query: 553 RPAPPPWPPRPRRGQAPRPRPPPARGPP--PSSRPPRRPRASPPPAPPPSAR-------- 404
           RP PPP PP P     P P PPP  G P  P   PP    ++PPP PPPS R        
Sbjct: 176 RPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPP 235

Query: 403 PSGSGHQRWPLP 368
           P G+G +  P P
Sbjct: 236 PPGAGGRAPPPP 247
 Score = 81.5 bits (198), Expect = 2e-15
 Identities = 49/106 (46%), Positives = 53/106 (49%), Gaps = 7/106 (6%)
 Frame = -3

Query: 715 PPLPRPRAH------PPLQPALPRPLPRPPWSPSRPRLAPRPPARPQLL-ARAPWPPPSR 557
           PP P P +H      PPL  A     P PP  P+    AP PP  P +  + AP  PP  
Sbjct: 104 PPPPPPISHSNAPPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPP 163

Query: 556 RRPAPPPWPPRPRRGQAPRPRPPPARGPPPSSRPPRRPRASPPPAPPPSARPS 398
             P PPP PP  R G  P P PP AR  PP   PP   R S PP PPP  R S
Sbjct: 164 PSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRAS 216
 Score = 78.8 bits (191), Expect = 2e-14
 Identities = 55/105 (52%), Positives = 58/105 (54%), Gaps = 31/105 (29%)
 Frame = -3

Query: 715 PPLPRPRAHPPLQPAL------PRPLPRPPWSPSRPRL-----APRPPARPQLLARAPWP 569
           PP P P   PPL+P+       P P P PP  PS P       AP PP  P LL   P P
Sbjct: 48  PPPPPP---PPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPP 104

Query: 568 PP-----------------SRRRPAPPPWPPRPRRGQAPRPRPPPA---RGPPPSSRPPR 449
           PP                 +R    PPP PP      AP P PPP     G PPS  PP 
Sbjct: 105 PPPPPISHSNAPPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPP 164

Query: 448 RPRASPPPAPPPSARP 401
            P   PPP PPP ARP
Sbjct: 165 SP---PPPPPPPGARP 177
 Score = 78.0 bits (189), Expect = 3e-14
 Identities = 52/107 (48%), Positives = 54/107 (49%), Gaps = 18/107 (16%)
 Frame = -3

Query: 715 PPLPRPRAH-----PPLQPALPRP--LPRPPWSPSRPRLAPRPPARPQLLARAPWPPPSR 557
           PP P P  H     PP  P + R    P PP  PS P   P P ARP      P PPP  
Sbjct: 131 PPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARP---GPPPPPPPPG 187

Query: 556 RRPAPPPWPPRPRRGQAPRPRPPP---ARGPPPSSRPPRRPRASPPP--------APPPS 410
            RP PPP PP P    +  P PPP   A  PPP   P  R  A PPP        APPP 
Sbjct: 188 ARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPP 247

Query: 409 ARPSG 395
             P G
Sbjct: 248 PAPGG 252
 Score = 69.9 bits (168), Expect = 8e-12
 Identities = 48/102 (47%), Positives = 52/102 (50%), Gaps = 14/102 (13%)
 Frame = -3

Query: 715 PPLPRPRAHPPLQ---PAL--PRPLPRPPWSPSRPRLAPRPPARPQLLARAPWPPPSR-- 557
           PP P P   PPL+   PA+  P P P PP  PS     P PP  P      P PPPS   
Sbjct: 30  PPAPPP---PPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPP-----PPPPPSAPS 81

Query: 556 -----RRPAPPPWPPRPRRGQAPRPRPP--PARGPPPSSRPPRRPRASPPPAPPPS 410
                  P PPP PP  R    P P PP   +  PPP   P  R  A PPP PPP+
Sbjct: 82  SRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAPPPPPPPPT 137
  9634.m00264|protein  transposon protein, putative, CACTA, En/Spm
           sub-class
           Length = 174
           
 Score = 84.3 bits (205), Expect = 4e-16
 Identities = 52/105 (49%), Positives = 57/105 (53%), Gaps = 4/105 (3%)
 Frame = +3

Query: 402 GRADGGGAGGGDARGRRGGREDGGGPRAGGGRGRGACPRRGRGGQG--GGAGRRRDGGGQ 575
           G+  G G GG   RG RGG   GGG   GGG G G     G+GG+G  GG G    GGG 
Sbjct: 16  GQPGGRGRGGRGGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGG 75

Query: 576 GARASSCGRAGGRGASRGRDGDQGGRGR--GRGSAGCSGGCARGRGRGG 716
           G      G AGG G + G  G  GG+GR  GRG  G SGG A GRG  G
Sbjct: 76  GGGKGRKGGAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGG-AGGRGGDG 123
 Score = 81.1 bits (197), Expect = 3e-15
 Identities = 51/116 (43%), Positives = 55/116 (46%), Gaps = 1/116 (0%)
 Frame = +3

Query: 402 GRADGGGAGGGDARGRRGGREDGGGPRAGGGRGRGACPRRGRGGQGGGAGRRRDGGGQGA 581
           G A GGG GGG   G  GG   GG    GG  G G     G GG GGG GR+   GG G 
Sbjct: 33  GGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAG--GGGGGGGGKGRKGGAGGHGG 90

Query: 582 RASSCGRAGGRGASRGRDGDQGGRGR-GRGSAGCSGGCARGRGRGGHRERVRRASTA 749
                G  GG+G   GR GD G  G  GRG  G SGG     GRGG    VR  + +
Sbjct: 91  AGGGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQG---GRGGDGGGVRSCTNS 144
 Score = 72.6 bits (175), Expect = 1e-12
 Identities = 47/101 (46%), Positives = 51/101 (49%), Gaps = 5/101 (4%)
 Frame = +3

Query: 420 GAGGGDARGRRGGREDGGGPRAGGGRGRGACPRRGRGGQGGGAGRRRDGGGQGARASSCG 599
           G  GG  RG RGGR   GG   GGG G         GG GGG G    GGG G +    G
Sbjct: 16  GQPGGRGRGGRGGRGGRGGASGGGGGG---------GGGGGGGG----GGGAGGKGGK-G 61

Query: 600 RAGGRGASRGRDGDQGGRGR-----GRGSAGCSGGCARGRGRGGHR 722
            AGG G + G  G  GG+GR     G G AG  GG   G+GR G R
Sbjct: 62  GAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGGKGRKGGR 107
 Score = 70.6 bits (170), Expect = 4e-12
 Identities = 50/102 (49%), Positives = 53/102 (51%), Gaps = 4/102 (3%)
 Frame = +3

Query: 402 GRADGGGAGGGDARGRRGGRED-GGGPRAGGGRGR--GACPRRGRGGQGGGAG-RRRDGG 569
           G   GGGAGG   +G  GG    GGG   GGG+GR  GA    G GG GGG G + R GG
Sbjct: 47  GGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGGKGRKGG 106

Query: 570 GQGARASSCGRAGGRGASRGRDGDQGGRGRGRGSAGCSGGCARGRG 707
             G   S  G AGGRG   G  G QGGRG   G  G    C   RG
Sbjct: 107 RGGDGGS--GGAGGRGGD-GGSGGQGGRG---GDGGGVRSCTNSRG 146
  9640.m04219|protein  retrotransposon protein, putative, Ty3-gypsy
           sub-class
           Length = 440
           
 Score = 83.9 bits (204), Expect = 5e-16
 Identities = 53/108 (49%), Positives = 66/108 (61%), Gaps = 19/108 (17%)
 Frame = -3

Query: 730 TRSRWPPLPRPRAHPPLQPALPRPLPRPPWSPSRPRLAPRPPA-RPQLLARAPWPPPSRR 554
           TR+R  P  RP   PP++P  P  LP PP  P  P   PRPP+ +P ++   P PPPS +
Sbjct: 131 TRTRVEPPHRP---PPVKPQPPPSLPPPP-PPPPPPPPPRPPSVKPPVVQPKPQPPPSLQ 186

Query: 553 RPAPPPWPP-RPR---------RGQAPRPRPPPARGPPPSSRPPRRPRASP--------P 428
            P+PPP PP RP          + Q P   PPP+  PPP + PPR P  +P        P
Sbjct: 187 PPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPPTVPPRTPGDTPAVVEPKPQP 246

Query: 427 PAPPPSA 407
           P PPP A
Sbjct: 247 PPPPPRA 253
 Score = 74.5 bits (180), Expect = 3e-13
 Identities = 43/101 (42%), Positives = 54/101 (52%), Gaps = 10/101 (9%)
 Frame = -3

Query: 715 PPLPRPRAHPPLQPALPRPLPRPPWSPSRPRLAPRPPAR-----PQLLARAPWPPPSRRR 551
           PP P P   P ++P + +P P+PP S   P   P PP R     P ++   P PPP+   
Sbjct: 159 PPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPP 218

Query: 550 PAPPPWPPR-PRRGQAPRP---RPPPARGPPPSSRPPRRPRA-SPPPAPPP 413
           P+PPP PP  P R     P    P P   PPP   P + PR   P P+PPP
Sbjct: 219 PSPPPPPPTVPPRTPGDTPAVVEPKPQPPPPPPRAPVKMPRVLEPKPSPPP 269
 Score = 73.0 bits (176), Expect = 9e-13
 Identities = 50/118 (42%), Positives = 60/118 (50%), Gaps = 8/118 (6%)
 Frame = -3

Query: 754 AAAVDARLTRSRWPPLPRPRAHPPLQPALPRPLPRPPWSPSRPRLAPRPPARPQLLARAP 575
           AAAVD   + +  P    P       PAL  P+P PP  P R R    PP RP  +   P
Sbjct: 98  AAAVDVDESSATSPEFKTP-------PALS-PVPPPP-PPPRTRTRVEPPHRPPPVK--P 146

Query: 574 WPPPSRRRPAPPPWPPRPRRGQA-------PRPRPPPARGPP-PSSRPPRRPRASPPPAP 419
            PPPS   P PPP PP P R  +       P+P+PPP+  PP P   PP RP +  PP  
Sbjct: 147 QPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVV 206

Query: 418 PPSARP 401
            P  +P
Sbjct: 207 QPKPQP 212
 Score = 71.4 bits (172), Expect = 3e-12
 Identities = 44/106 (41%), Positives = 58/106 (54%), Gaps = 17/106 (16%)
 Frame = -3

Query: 715 PPLPRPRAHPPLQPALPRPLPRPPWSPSRPRLAPRPPARPQLLARAPWPPPSRRRPAPPP 536
           PP P P   P ++P + +P P+PP  P+ P  +P PP  P +  R P   P+   P P P
Sbjct: 190 PPPPPPTRPPSVKPPVVQPKPQPP--PTLPPPSPPPPP-PTVPPRTPGDTPAVVEPKPQP 246

Query: 535 WPPRPR------RGQAPRPRPPPAR-GPPP----------SSRPPRRPRASPPPAPPPSA 407
            PP PR      R   P+P PPP    PPP          +   P +P+  PP  PPP  
Sbjct: 247 PPPPPRAPVKMPRVLEPKPSPPPPSPLPPPPEDYWSPTAVTPPEPTKPKPPPPSPPPPPQ 306

Query: 406 RPS 398
           +PS
Sbjct: 307 QPS 309
 Score = 70.6 bits (170), Expect = 4e-12
 Identities = 46/108 (42%), Positives = 59/108 (54%), Gaps = 26/108 (24%)
 Frame = -3

Query: 715 PPLPRPRAHPPLQPALPRPLPRPPWSPSRPRL-------------APRPPAR-----PQL 590
           PP+ +P+  PP  P LP P P PP     PR               P PP R     P++
Sbjct: 203 PPVVQPKPQPP--PTLPPPSPPPPPPTVPPRTPGDTPAVVEPKPQPPPPPPRAPVKMPRV 260

Query: 589 LARAPWPPPSRRRPAPPP--WPPRPRRGQAP-RPRPPPARGPPPSSRPPRR-----PRAS 434
           L   P PPP    P PP   W P       P +P+PPP   PPP  +P +R     P  +
Sbjct: 261 LEPKPSPPPPSPLPPPPEDYWSPTAVTPPEPTKPKPPPPSPPPPPQQPSQRYWTPPPAIT 320

Query: 433 PPPAPPPSARPSGS 392
           P PA P + +P+ S
Sbjct: 321 PEPAKPAAGKPTSS 334
 Score = 66.7 bits (160), Expect = 7e-11
 Identities = 48/114 (42%), Positives = 57/114 (49%), Gaps = 12/114 (10%)
 Frame = -3

Query: 715 PPLPRPRA--------HPPLQPALPRPLPRPP---WSPSRPRLAPRPPARPQLLARAPWP 569
           PP P PRA         P   P  P PLP PP   WSP+   + P  P +P+     P P
Sbjct: 246 PPPPPPRAPVKMPRVLEPKPSPPPPSPLPPPPEDYWSPTA--VTPPEPTKPK--PPPPSP 301

Query: 568 PPSRRRPAPPPWPPRPRRGQAPRPRPP-PARGPPPSSRPPRRPRASPPPAPPPSARPSGS 392
           PP  ++P+   W P P    A  P P  PA G P SS PP    +  PP P PS   +G 
Sbjct: 302 PPPPQQPSQRYWTPPP----AITPEPAKPAAGKPTSSSPPSTKDSPRPPLPAPSPAANG- 356

Query: 391 GHQRWP 374
           G  R P
Sbjct: 357 GDPRLP 362
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84380859 Number of Sequences: 59712 Number of extensions: 3649490 Number of successful extensions: 198435 Number of sequences better than 1.0e-10: 86 Number of HSP's better than 0.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 54 Number of HSP's that attempted gapping in prelim test: 185030 Number of HSP's gapped (non-prelim): 2886 length of query: 361 length of database: 26,991,925 effective HSP length: 51 effective length of query: 309 effective length of database: 23,946,613 effective search space: 7399503417 effective search space used: 7399503417 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG76   Members:15             3pri:Y   6e-43      
P19177           Histone H2A pir||S11498 histone H2A - parsley
         (681 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9631.m01677|protein  Similar to histone H2A-like protein        256  4e-68
 9629.m02961|protein  Similar to histone H2A-like protein        256  4e-68
 9633.m00149|protein  histone H2A-like protein                   242  5e-64
 9633.m03589|protein  Similar to histone H2A-like protein        242  7e-64
 9640.m03333|protein  histone h2a. [norway spruce, picea ex...   171  1e-42
 9631.m05003|protein  Core histone H2A/H2B/H3/H4                 169  6e-42
 9640.m02397|protein  histone H2A (clone TH254) - wheat          169  6e-42
 9635.m03571|protein  histone H2A (clone TH254) - wheat          169  6e-42
 9636.m03314|protein  Core histone H2A/H2B/H3/H4                 168  7e-42
 9635.m03572|protein  histone H2A protein, putative              168  9e-42
 9631.m05214|protein  putative histone H2A protein               121  1e-27
 9631.m00595|protein  Core histone H2A/H2B/H3/H4                 121  1e-27
 9638.m02385|protein  histone H2A, putative                      120  3e-27
 9632.m01228|protein  histone H2A                                112  6e-25
 9636.m01888|protein  Similar to histone h2a.2.2. [wheat          82  1e-15
 9635.m03701|protein  hypothetical protein                        70  3e-12

  9631.m01677|protein  Similar to histone H2A-like protein
           Length = 159
           
 Score =  256 bits (646), Expect = 4e-68
 Identities = 133/153 (86%), Positives = 145/153 (93%), Gaps = 6/153 (3%)
 Frame = +2

Query: 77  MEVSGAAAKGK--KGAAGRKAGGPRKKSVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTG 250
           M+ +GA A GK  KGAAGRKAGGPRKK+V+RSVKAGLQFPVGRIGRYLKKGRYAQR+GTG
Sbjct: 1   MDAAGAGAGGKLKKGAAGRKAGGPRKKAVSRSVKAGLQFPVGRIGRYLKKGRYAQRIGTG 60

Query: 251 APVYLAAVLEYLAAELLELAGNAAKDNKKSRIIPRHLLLAVRNDEELGKLLAGVTIAHGG 430
           APVYLAAVLEYLAAE+LELAGNAA+DNKK+RIIPRH+LLA+RNDEELGKLLAGVTIAHGG
Sbjct: 61  APVYLAAVLEYLAAEVLELAGNAARDNKKNRIIPRHVLLAIRNDEELGKLLAGVTIAHGG 120

Query: 431 VIPKINPVLLPKRTAEK---EGKGPKSPKKAT-KSPKKA 535
           V+P INPVLLPK+TAEK    GK  KSPKKA  KSPKKA
Sbjct: 121 VLPNINPVLLPKKTAEKAAAAGKEAKSPKKAAGKSPKKA 159
  9629.m02961|protein  Similar to histone H2A-like protein
           Length = 159
           
 Score =  256 bits (646), Expect = 4e-68
 Identities = 133/153 (86%), Positives = 145/153 (93%), Gaps = 6/153 (3%)
 Frame = +2

Query: 77  MEVSGAAAKGK--KGAAGRKAGGPRKKSVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTG 250
           M+ +GA A GK  KGAAGRKAGGPRKK+V+RSVKAGLQFPVGRIGRYLKKGRYAQR+GTG
Sbjct: 1   MDAAGAGAGGKLKKGAAGRKAGGPRKKAVSRSVKAGLQFPVGRIGRYLKKGRYAQRIGTG 60

Query: 251 APVYLAAVLEYLAAELLELAGNAAKDNKKSRIIPRHLLLAVRNDEELGKLLAGVTIAHGG 430
           APVYLAAVLEYLAAE+LELAGNAA+DNKK+RIIPRH+LLA+RNDEELGKLLAGVTIAHGG
Sbjct: 61  APVYLAAVLEYLAAEVLELAGNAARDNKKNRIIPRHVLLAIRNDEELGKLLAGVTIAHGG 120

Query: 431 VIPKINPVLLPKRTAEK---EGKGPKSPKKAT-KSPKKA 535
           V+P INPVLLPK+TAEK    GK  KSPKKA  KSPKKA
Sbjct: 121 VLPNINPVLLPKKTAEKAAAAGKEAKSPKKAAGKSPKKA 159
  9633.m00149|protein  histone H2A-like protein
           Length = 156
           
 Score =  242 bits (611), Expect = 5e-64
 Identities = 122/152 (80%), Positives = 134/152 (87%), Gaps = 1/152 (0%)
 Frame = +2

Query: 89  GAAAKGKKGAAGRKAGGPRKKSVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLA 268
           G   K  K A GRK GGP+KK V+RSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLA
Sbjct: 4   GVGGKAAKKAVGRKLGGPKKKPVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLA 63

Query: 269 AVLEYLAAELLELAGNAAKDNKKSRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVIPKIN 448
           AVLEYLAAE+LELAGNAA+DNKK+RIIPRH+LLA+RNDEELGKLLAGVTIAHGGV+P IN
Sbjct: 64  AVLEYLAAEVLELAGNAARDNKKNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGVLPNIN 123

Query: 449 PVLLPKRTAEKEGKGPKSPK-KATKSPKKATKA 544
           PVLLPK+TAEK  K  K+ K KA KSPKK  ++
Sbjct: 124 PVLLPKKTAEKADKPAKASKDKAAKSPKKQARS 156
  9633.m03589|protein  Similar to histone H2A-like protein
           Length = 163
           
 Score =  242 bits (610), Expect = 7e-64
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 8/156 (5%)
 Frame = +2

Query: 77  MEVSGAAAKGKKGAAGRKAGG-PRKKSVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGA 253
           MEV GA    K GA GR+ GG P+KK V+RSVKAGLQFPVGRIGRYLK+GRY+QR+GTGA
Sbjct: 1   MEV-GAKVPKKAGAGGRRGGGGPKKKPVSRSVKAGLQFPVGRIGRYLKQGRYSQRIGTGA 59

Query: 254 PVYLAAVLEYLAAELLELAGNAAKDNKKSRIIPRHLLLAVRNDEELGKLLAGVTIAHGGV 433
           PVYLAAVLEYLAAE+LELAGNAA+DNKK+RIIPRH+LLA+RNDEELGKLLAGVTIAHGGV
Sbjct: 60  PVYLAAVLEYLAAEVLELAGNAARDNKKNRIIPRHVLLAIRNDEELGKLLAGVTIAHGGV 119

Query: 434 IPKINPVLLPKRTAE------KEGKGPKSPKKA-TKSPKKATKA 544
           +P INPVLLPK+T        KEGK PKSPKKA TKSPKKA  A
Sbjct: 120 LPNINPVLLPKKTGSAAAKEAKEGKTPKSPKKATTKSPKKAAAA 163
  9640.m03333|protein  histone h2a. [norway spruce, picea excelsa
           Length = 138
           
 Score =  171 bits (428), Expect = 1e-42
 Identities = 84/119 (70%), Positives = 98/119 (81%)
 Frame = +2

Query: 113 GAAGRKAGGPRKKSVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAA 292
           G  G +      KSV+RS KAGLQFPVGRI RYLK G+YA+RVG GAPVYL+AVLEYLAA
Sbjct: 5   GGGGGRGKSKGSKSVSRSSKAGLQFPVGRIARYLKAGKYAERVGAGAPVYLSAVLEYLAA 64

Query: 293 ELLELAGNAAKDNKKSRIIPRHLLLAVRNDEELGKLLAGVTIAHGGVIPKINPVLLPKR 469
           E+LELAGNAA+DNKK+RI+PRH+ LAVRNDEEL +LL  VTIA GGV+P I+  LLPK+
Sbjct: 65  EVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSRLLGAVTIAAGGVLPNIHQTLLPKK 123
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47884619 Number of Sequences: 59712 Number of extensions: 1565741 Number of successful extensions: 25814 Number of sequences better than 1.0e-10: 32 Number of HSP's better than 0.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 25782 Number of HSP's gapped (non-prelim): 19 length of query: 227 length of database: 26,991,925 effective HSP length: 50 effective length of query: 176 effective length of database: 24,006,325 effective search space: 4225113200 effective search space used: 4225113200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 157 (65.6 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG86   Members:123            3pri:Y   1e-129     
P05167           Thiol protease aleurain precursor emb|CAA28804.1|
aleurain [Hordeum vulgare]
         (1572 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9637.m02366|protein  oryzain gamma chain precursor (ec 3.4...   638  0.0
 9637.m02365|protein  oryzain gamma chain precursor (ec 3.4...   638  0.0
 9632.m05607|protein  Papain family cysteine protease, puta...   249  8e-66
 9639.m01379|protein  cysteine proteinase (EC 3.4.22.-) - rice   238  3e-62
 9639.m01378|protein  cysteine proteinase (EC 3.4.22.-) - rice   238  3e-62
 9635.m00082|protein  Papain family cysteine protease, puta...   230  4e-60
 9632.m05612|protein  Papain family cysteine protease, puta...   227  5e-59
 9637.m02821|protein  senescence-specific cysteine protease...   224  3e-58
 9632.m01184|protein  Papain family cysteine protease, puta...   221  3e-57
 9629.m07334|protein  Papain family cysteine protease, puta...   220  6e-57
 9629.m06748|protein  Papain family cysteine protease, puta...   219  1e-56
 9631.m05317|protein  putative cysteine protease                 219  1e-56
 9630.m04725|protein  cysteine proteinase                        217  3e-56
 9629.m04106|protein  Papain family cysteine protease, puta...   215  2e-55
 9633.m00094|protein  cysteine proteinase, putative              214  3e-55
 9632.m01168|protein  Papain family cysteine protease, puta...   213  5e-55
 9636.m04511|protein  cysteine proteinase, putative              211  2e-54
 9632.m05417|protein  Similar to oryzain alpha chain precur...   210  5e-54
 9633.m04018|protein  cysteine proteinase (EC 3.4.22.-) [si...   206  6e-53
 9632.m01189|protein  Papain family cysteine protease, puta...   206  8e-53

  9637.m02366|protein  oryzain gamma chain precursor (ec 3.4.22.-)
            Length = 362
            
 Score =  638 bits (1627), Expect = 0.0
 Identities = 309/361 (85%), Positives = 331/361 (91%), Gaps = 2/361 (0%)
 Frame = +3

Query: 51   MAHARVLLL--ALAVLATAAVAVASSSSFADSNPIRPVTDRAASTLESAVLGALGRTRHA 224
            MAH R++LL  A AV AT+AVA A+SS F DSNPIR VTD AAS LES V+ ALGRTR A
Sbjct: 1    MAHRRIILLLAAAAVAATSAVA-AASSGFDDSNPIRSVTDHAASALESTVIAALGRTRDA 59

Query: 225  LRFARFAVRYGKSYESAAEVRRRFRIFSESLEEVRSTNRKGLPYRLGINRFSDMSWEEFQ 404
            LRFARFAVR+GK Y  AAEV+RRFRIFSESLE VRSTNR+GLPYRLGINRF+DMSWEEFQ
Sbjct: 60   LRFARFAVRHGKRYGDAAEVQRRFRIFSESLELVRSTNRRGLPYRLGINRFADMSWEEFQ 119

Query: 405  ATRLGAAQTCSATLAGNHLMRDAAALPETKDWREDGIVSPVKNQAHCGSCWTFSTTGALE 584
            A+RLGAAQ CSATLAGNH MRDAAALPETKDWREDGIVSPVK+Q HCGSCWTFSTTG+LE
Sbjct: 120  ASRLGAAQNCSATLAGNHRMRDAAALPETKDWREDGIVSPVKDQGHCGSCWTFSTTGSLE 179

Query: 585  AAYTQATGKNISLSEQQLVDCAGGFNNFGCNGGLPSQAFEYIKYNGGIDTEESYPYKGVN 764
            AAYTQATGK +SLSEQQLVDCA  +NNFGC+GGLPSQAFEYIKYNGG+DTEE+YPY GVN
Sbjct: 180  AAYTQATGKPVSLSEQQLVDCATAYNNFGCSGGLPSQAFEYIKYNGGLDTEEAYPYTGVN 239

Query: 765  GVCHYKAENAAVQVLDSVNITLNAEDELKNAVGLVRPVSVAFQVIDGFRQYKSGVYTSDH 944
            G+CHYK EN  V+VLDSVNITL AEDELKNAVGLVRPVSVAFQVI+GFR YKSGVYTSDH
Sbjct: 240  GICHYKPENVGVKVLDSVNITLGAEDELKNAVGLVRPVSVAFQVINGFRMYKSGVYTSDH 299

Query: 945  CGTTPDDVNHAVLAVGYGVENGVPYWLIKNSWGADWGDNGYFKMEMGKNMCAIATCASYP 1124
            CGT+P DVNHAVLAVGYGVENGVPYWLIKNSWGADWGDNGYFKMEMGKNMC IATCASYP
Sbjct: 300  CGTSPMDVNHAVLAVGYGVENGVPYWLIKNSWGADWGDNGYFKMEMGKNMCGIATCASYP 359

Query: 1125 VVA 1133
            +VA
Sbjct: 360  IVA 362
  9637.m02365|protein  oryzain gamma chain precursor (ec 3.4.22.-)
            Length = 362
            
 Score =  638 bits (1627), Expect = 0.0
 Identities = 309/361 (85%), Positives = 331/361 (91%), Gaps = 2/361 (0%)
 Frame = +3

Query: 51   MAHARVLLL--ALAVLATAAVAVASSSSFADSNPIRPVTDRAASTLESAVLGALGRTRHA 224
            MAH R++LL  A AV AT+AVA A+SS F DSNPIR VTD AAS LES V+ ALGRTR A
Sbjct: 1    MAHRRIILLLAAAAVAATSAVA-AASSGFDDSNPIRSVTDHAASALESTVIAALGRTRDA 59

Query: 225  LRFARFAVRYGKSYESAAEVRRRFRIFSESLEEVRSTNRKGLPYRLGINRFSDMSWEEFQ 404
            LRFARFAVR+GK Y  AAEV+RRFRIFSESLE VRSTNR+GLPYRLGINRF+DMSWEEFQ
Sbjct: 60   LRFARFAVRHGKRYGDAAEVQRRFRIFSESLELVRSTNRRGLPYRLGINRFADMSWEEFQ 119

Query: 405  ATRLGAAQTCSATLAGNHLMRDAAALPETKDWREDGIVSPVKNQAHCGSCWTFSTTGALE 584
            A+RLGAAQ CSATLAGNH MRDAAALPETKDWREDGIVSPVK+Q HCGSCWTFSTTG+LE
Sbjct: 120  ASRLGAAQNCSATLAGNHRMRDAAALPETKDWREDGIVSPVKDQGHCGSCWTFSTTGSLE 179

Query: 585  AAYTQATGKNISLSEQQLVDCAGGFNNFGCNGGLPSQAFEYIKYNGGIDTEESYPYKGVN 764
            AAYTQATGK +SLSEQQLVDCA  +NNFGC+GGLPSQAFEYIKYNGG+DTEE+YPY GVN
Sbjct: 180  AAYTQATGKPVSLSEQQLVDCATAYNNFGCSGGLPSQAFEYIKYNGGLDTEEAYPYTGVN 239

Query: 765  GVCHYKAENAAVQVLDSVNITLNAEDELKNAVGLVRPVSVAFQVIDGFRQYKSGVYTSDH 944
            G+CHYK EN  V+VLDSVNITL AEDELKNAVGLVRPVSVAFQVI+GFR YKSGVYTSDH
Sbjct: 240  GICHYKPENVGVKVLDSVNITLGAEDELKNAVGLVRPVSVAFQVINGFRMYKSGVYTSDH 299

Query: 945  CGTTPDDVNHAVLAVGYGVENGVPYWLIKNSWGADWGDNGYFKMEMGKNMCAIATCASYP 1124
            CGT+P DVNHAVLAVGYGVENGVPYWLIKNSWGADWGDNGYFKMEMGKNMC IATCASYP
Sbjct: 300  CGTSPMDVNHAVLAVGYGVENGVPYWLIKNSWGADWGDNGYFKMEMGKNMCGIATCASYP 359

Query: 1125 VVA 1133
            +VA
Sbjct: 360  IVA 362
  9632.m05607|protein  Papain family cysteine protease, putative
            Length = 466
            
 Score =  249 bits (630), Expect = 8e-66
 Identities = 157/370 (42%), Positives = 207/370 (55%), Gaps = 10/370 (2%)
 Frame = +3

Query: 54   AHARVLLLALAVLATAAVAVASSSSFADSNPIRPVTDRAASTLESAVLGALGRTRHALRF 233
            A A  LLL +   ATAA          D + I    +  A  LE     A  R  + L  
Sbjct: 6    AAAAFLLLLIVGAATAA---------PDMSIISYNAEHGARGLEEGPTEAEARAAYDLWL 56

Query: 234  ARFAVRYGKSYESAAEVRRRFRIFSESLEEVRSTNRKGLP---YRLGINRFSDMSWEEFQ 404
            A      G       E  RRF +F ++L+ V + N +      +RLG+NRF+D++ EEF+
Sbjct: 57   AENGG--GSPNALGGEHERRFLVFWDNLKFVDAHNARADERGGFRLGMNRFADLTNEEFR 114

Query: 405  ATRLGAAQTCSATLAGNHLMRDAAA-LPETKDWREDGIVSPVKNQAHCGSCWTFSTTGAL 581
            AT LGA     +  AG     D    LPE+ DWRE G V+PVKNQ  CGSCW FS    +
Sbjct: 115  ATFLGAKVAERSRAAGERYRHDGVEELPESVDWREKGAVAPVKNQGQCGSCWAFSAVSTV 174

Query: 582  EAAYTQATGKNISLSEQQLVDCAGGFNNFGCNGGLPSQAFEYIKYNGGIDTEESYPYKGV 761
            E+     TG+ I+LSEQ+LV+C+    N GCNGGL   AF++I  NGGIDTE+ YPYK V
Sbjct: 175  ESINQLVTGEMITLSEQELVECSTNGQNSGCNGGLMDDAFDFIIKNGGIDTEDDYPYKAV 234

Query: 762  NGVCHYKAENAAVQVLDSV-NITLNAEDELKNAVGLVRPVSVAFQVID-GFRQYKSGVYT 935
            +G C    ENA V  +D   ++  N E  L+ AV   +PVSVA +     F+ Y SGV+ 
Sbjct: 235  DGKCDINRENAKVVSIDGFEDVPQNDEKSLQKAVA-HQPVSVAIEAGGREFQLYHSGVF- 292

Query: 936  SDHCGTTPDDVNHAVLAVGYGVENGVPYWLIKNSWGADWGDNGYFKMEMGKNM----CAI 1103
            S  CGT+ D   H V+AVGYG +NG  YW+++NSWG  WG++GY +ME   N+    C I
Sbjct: 293  SGRCGTSLD---HGVVAVGYGTDNGKDYWIVRNSWGPKWGESGYVRMERNINVTTGKCGI 349

Query: 1104 ATCASYPVVAA*RSAKSAST 1163
            A  ASYP  +     K + T
Sbjct: 350  AMMASYPTKSGANPPKPSPT 369
  9639.m01379|protein  cysteine proteinase (EC 3.4.22.-) - rice
            Length = 378
            
 Score =  238 bits (600), Expect = 3e-62
 Identities = 152/368 (41%), Positives = 215/368 (58%), Gaps = 19/368 (5%)
 Frame = +3

Query: 63   RVLLLALAVLATAAVAVASSSSFADSNPIRPVTDRAASTLESAVLGAL-GRTRHALRFAR 239
            R  L+A A +A AA A A + +        P T+   S+ ES  L AL  R R     +R
Sbjct: 3    RCFLVAAAAVALAAAAAAPARAI-------PFTESDLSSEES--LRALYERWRSRYTVSR 53

Query: 240  FAVRYGKSYESAAEVRRRFRIFSESLEEVRSTNRKG-LPYRLGINRFSDMSWEEFQATRL 416
             A   G   +   E RRRF +F E+   +   NR+G  P+RL +N+F+DM+ +EF+ T  
Sbjct: 54   PAASGGVGNDDG-EARRRFNVFVENARYIHEANRRGGRPFRLALNKFADMTTDEFRRTYA 112

Query: 417  GAAQTCSATLAGNHLMR---------DAAALPETKDWREDGIVSPVKNQAHCGSCWTFST 569
            G+      +L+G              D   LP   DWRE G V+ +K+Q  CGSCW FST
Sbjct: 113  GSRARHHRSLSGGRGGEGGSFRYGGDDEDNLPPAVDWRERGAVTGIKDQGQCGSCWAFST 172

Query: 570  TGALEAAYTQATGKNISLSEQQLVDCAGGFNNFGCNGGLPSQAFEYIKYNGGIDTEESYP 749
              A+E      TG+ ++LSEQ+LVDC  G +N GC+GGL   AF++IK NGGI TE +YP
Sbjct: 173  VAAVEGVNKIKTGRLVTLSEQELVDCDTG-DNQGCDGGLMDYAFQFIKRNGGITTESNYP 231

Query: 750  YKGVNGVCH-YKAENAAVQVLDSVNITLNAEDELKNAVGLVRPVSVAFQVI-DGFRQYKS 923
            Y+   G C+  KA +  V +    ++  N E  L+ AV   +PV+VA +     F+ Y  
Sbjct: 232  YRAEQGRCNKAKASSHDVTIDGYEDVPANDESALQKAVA-NQPVAVAVEASGQDFQFYSE 290

Query: 924  GVYTSDHCGTTPDDVNHAVLAVGYGV-ENGVPYWLIKNSWGADWGDNGYFKMEMG----- 1085
            GV+T + CGT   D++H V AVGYG+  +G  YW++KNSWG DWG+ GY +M+ G     
Sbjct: 291  GVFTGE-CGT---DLDHGVAAVGYGITRDGTKYWIVKNSWGEDWGERGYIRMQRGVSSDS 346

Query: 1086 KNMCAIATCASYPVVAA*RSAKSASTV 1166
              +C IA  ASYPV +  R+A +++ V
Sbjct: 347  NGLCGIAMEASYPVKSGARNAAASNRV 373
  9639.m01378|protein  cysteine proteinase (EC 3.4.22.-) - rice
            Length = 378
            
 Score =  238 bits (600), Expect = 3e-62
 Identities = 152/368 (41%), Positives = 215/368 (58%), Gaps = 19/368 (5%)
 Frame = +3

Query: 63   RVLLLALAVLATAAVAVASSSSFADSNPIRPVTDRAASTLESAVLGAL-GRTRHALRFAR 239
            R  L+A A +A AA A A + +        P T+   S+ ES  L AL  R R     +R
Sbjct: 3    RCFLVAAAAVALAAAAAAPARAI-------PFTESDLSSEES--LRALYERWRSRYTVSR 53

Query: 240  FAVRYGKSYESAAEVRRRFRIFSESLEEVRSTNRKG-LPYRLGINRFSDMSWEEFQATRL 416
             A   G   +   E RRRF +F E+   +   NR+G  P+RL +N+F+DM+ +EF+ T  
Sbjct: 54   PAASGGVGNDDG-EARRRFNVFVENARYIHEANRRGGRPFRLALNKFADMTTDEFRRTYA 112

Query: 417  GAAQTCSATLAGNHLMR---------DAAALPETKDWREDGIVSPVKNQAHCGSCWTFST 569
            G+      +L+G              D   LP   DWRE G V+ +K+Q  CGSCW FST
Sbjct: 113  GSRARHHRSLSGGRGGEGGSFRYGGDDEDNLPPAVDWRERGAVTGIKDQGQCGSCWAFST 172

Query: 570  TGALEAAYTQATGKNISLSEQQLVDCAGGFNNFGCNGGLPSQAFEYIKYNGGIDTEESYP 749
              A+E      TG+ ++LSEQ+LVDC  G +N GC+GGL   AF++IK NGGI TE +YP
Sbjct: 173  VAAVEGVNKIKTGRLVTLSEQELVDCDTG-DNQGCDGGLMDYAFQFIKRNGGITTESNYP 231

Query: 750  YKGVNGVCH-YKAENAAVQVLDSVNITLNAEDELKNAVGLVRPVSVAFQVI-DGFRQYKS 923
            Y+   G C+  KA +  V +    ++  N E  L+ AV   +PV+VA +     F+ Y  
Sbjct: 232  YRAEQGRCNKAKASSHDVTIDGYEDVPANDESALQKAVA-NQPVAVAVEASGQDFQFYSE 290

Query: 924  GVYTSDHCGTTPDDVNHAVLAVGYGV-ENGVPYWLIKNSWGADWGDNGYFKMEMG----- 1085
            GV+T + CGT   D++H V AVGYG+  +G  YW++KNSWG DWG+ GY +M+ G     
Sbjct: 291  GVFTGE-CGT---DLDHGVAAVGYGITRDGTKYWIVKNSWGEDWGERGYIRMQRGVSSDS 346

Query: 1086 KNMCAIATCASYPVVAA*RSAKSASTV 1166
              +C IA  ASYPV +  R+A +++ V
Sbjct: 347  NGLCGIAMEASYPVKSGARNAAASNRV 373
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 111007843 Number of Sequences: 59712 Number of extensions: 3904174 Number of successful extensions: 118828 Number of sequences better than 1.0e-10: 71 Number of HSP's better than 0.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 21 Number of HSP's that attempted gapping in prelim test: 118112 Number of HSP's gapped (non-prelim): 127 length of query: 524 length of database: 26,991,925 effective HSP length: 52 effective length of query: 471 effective length of database: 23,886,901 effective search space: 11250730371 effective search space used: 11250730371 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG89   Members:156            3pri:Y   1e-137     
O22347           Tubulin alpha-1 chain (Alpha-1 tubulin)
gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
         (1702 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9631.m05042|protein  alpha-tubulin                              910  0.0
 9635.m03858|protein  tubulin alpha-1 chain                      867  0.0
 9631.m01118|protein  tubulin alpha-2 chain (alpha-2 tubulin)    825  0.0
 9634.m04473|protein  beta-tubulin R2242 - rice                  395  e-109
 9630.m00647|protein  tubulin beta chain (fragment)              393  e-109
 9629.m01752|protein  tubulin beta-5 chain (beta-5 tubulin)      392  e-108
 9633.m03161|protein  tubulin beta-5 chain (beta-5 tubulin)      392  e-108
 9631.m00057|protein  Tubulin/FtsZ family, GTPase domain, p...   391  e-108
 9629.m05808|protein  beta-tubulin R1623 - rice                  391  e-108
 9629.m05807|protein  beta-tubulin R1623 - rice                  391  e-108
 9631.m05571|protein  beta-tubulin                               390  e-108
 9631.m05570|protein  beta-tubulin                               390  e-108
 9631.m04449|protein  tubulin beta subunit                       387  e-107
 9633.m00567|protein  tubulin gamma-2 chain (gamma-2 tubulin)    243  6e-64

  9631.m05042|protein  alpha-tubulin
            Length = 451
            
 Score =  910 bits (2325), Expect = 0.0
 Identities = 441/451 (97%), Positives = 445/451 (97%)
 Frame = +3

Query: 153  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK 332
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP D+TVGGGDDAFNTFFSETGAGK
Sbjct: 1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTFFSETGAGK 60

Query: 333  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD 512
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct: 61   HVPRAVFVDLEPTVIDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD 120

Query: 513  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS 692
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS
Sbjct: 121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS 180

Query: 693  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTA 872
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTA
Sbjct: 181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTA 240

Query: 873  SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS 1052
            SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS
Sbjct: 241  SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS 300

Query: 1053 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP 1232
            MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP
Sbjct: 301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP 360

Query: 1233 SVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 1412
            SVVP GDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct: 361  SVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE 420

Query: 1413 AREDLAALEKDYEEVGAEFDEGEDGDEGDEY 1505
            AREDLAALEKDYEEVGAE DE EDGD+GDEY
Sbjct: 421  AREDLAALEKDYEEVGAESDENEDGDDGDEY 451
  9635.m03858|protein  tubulin alpha-1 chain
            Length = 450
            
 Score =  867 bits (2216), Expect = 0.0
 Identities = 416/451 (92%), Positives = 435/451 (96%)
 Frame = +3

Query: 153  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK 332
            MRE ISIHIGQAGIQVGNACWELYCLEHGI+PDG MP D TVG   DAFNTFFSETGAGK
Sbjct: 1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTTVGVAHDAFNTFFSETGAGK 60

Query: 333  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD 512
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct: 61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120

Query: 513  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS 692
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct: 121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180

Query: 693  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTA 872
            VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRL+SQ+ISSLT 
Sbjct: 181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTT 240

Query: 873  SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS 1052
            SLRFDGA+NVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV EITN+ FEPSS
Sbjct: 241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300

Query: 1053 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP 1232
            MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct: 301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360

Query: 1233 SVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 1412
            SVVPGGDLAKVQRAVCMISN+T+V EVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
Sbjct: 361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420

Query: 1413 AREDLAALEKDYEEVGAEFDEGEDGDEGDEY 1505
            AREDLAALEKDYEEVGAE  + E+ D+G++Y
Sbjct: 421  AREDLAALEKDYEEVGAEGADDEN-DDGEDY 450
  9631.m01118|protein  tubulin alpha-2 chain (alpha-2 tubulin)
            Length = 449
            
 Score =  825 bits (2108), Expect = 0.0
 Identities = 392/451 (86%), Positives = 423/451 (92%)
 Frame = +3

Query: 153  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK 332
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MP D T G   DAFNTFFSET +GK
Sbjct: 1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTTPGIARDAFNTFFSETSSGK 60

Query: 333  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD 512
            HVPRA+FVDLEPTVIDEV+TG YRQLFHPEQLIS KEDAANNFARGHYT+G+E+VDLCLD
Sbjct: 61   HVPRALFVDLEPTVIDEVKTGPYRQLFHPEQLISYKEDAANNFARGHYTVGREVVDLCLD 120

Query: 513  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS 692
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFT+YPSPQ+ST+
Sbjct: 121  RLRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA 180

Query: 693  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTA 872
            VVEPYNSVLSTHSL+EHTDV VLLDNEAIYDIC+RSLDIERPTYTNLNRL+SQVISSLT 
Sbjct: 181  VVEPYNSVLSTHSLIEHTDVVVLLDNEAIYDICKRSLDIERPTYTNLNRLISQVISSLTT 240

Query: 873  SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS 1052
            SLRFDGA+NVD+ EFQTNLVPYPRIHFMLSSYAP+IS EKA+HEQ SV EITNS FEP+S
Sbjct: 241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPIISVEKAFHEQHSVPEITNSVFEPAS 300

Query: 1053 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP 1232
            +MAKCDPRHGKYMACCLMYRGDVVPKDVNAAV +IKT+RT+QFVDWCPTGFKCGINYQPP
Sbjct: 301  VMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVHSIKTRRTVQFVDWCPTGFKCGINYQPP 360

Query: 1233 SVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 1412
            + VPGGDLAKV+RAVCMISN+T+V EVFSRID KFDLMYAKRAFVHWYVGEGMEEGEFSE
Sbjct: 361  TAVPGGDLAKVRRAVCMISNNTAVAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSE 420

Query: 1413 AREDLAALEKDYEEVGAEFDEGEDGDEGDEY 1505
            AREDLAALEKDYEEVGAE +  +D +E  EY
Sbjct: 421  AREDLAALEKDYEEVGAEVE--DDDEEQGEY 449
  9634.m04473|protein  beta-tubulin R2242 - rice
            Length = 446
            
 Score =  395 bits (1004), Expect = e-109
 Identities = 189/450 (42%), Positives = 286/450 (63%), Gaps = 3/450 (0%)
 Frame = +3

Query: 153  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK 332
            MRE + I  GQ G Q+G   WE+ C EHGI   G+  GD  +    +  N +++E   G+
Sbjct: 1    MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSDLQL--ERINVYYNEASGGR 58

Query: 333  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD 512
            +VPRAV +DLEP  +D VR+G Y Q+F P+  + G+  A NN+A+GHYT G E++D  LD
Sbjct: 59   YVPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLD 118

Query: 513  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS 692
             +RK A+NC  LQGF V +++GGGTGSG+G+LL+ ++  +Y  +  L F+V+PSP+VS +
Sbjct: 119  VVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDT 178

Query: 693  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTA 872
            VVEPYN+ LS H L+E+ D  ++LDNEA+YDIC R+L +  PT+ +LN L+S  +S +T 
Sbjct: 179  VVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLNHLISATMSGVTC 238

Query: 873  SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS 1052
             LRF G LN D+ +   NL+P+PR+HF +  +AP+ S     +  L+V E+T   ++  +
Sbjct: 239  CLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKN 298

Query: 1053 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP 1232
            MM   DPRHG+Y+    M+RG +  K+V+  +  ++ K +  FV+W P   K  +   PP
Sbjct: 299  MMCAADPRHGRYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSSVCDIPP 358

Query: 1233 SVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 1412
                      ++ A   I NSTS+ E+F R+  +F  M+ ++AF+HWY GEGM+E EF+E
Sbjct: 359  --------IGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTE 410

Query: 1413 AR---EDLAALEKDYEEVGAEFDEGEDGDEGDE 1502
            A     DL A  + Y++  AE ++ E+ +E +E
Sbjct: 411  AESNMNDLVAEYQQYQDATAEEEDYEEEEEDEE 443
  9630.m00647|protein  tubulin beta chain (fragment)
            Length = 447
            
 Score =  393 bits (1000), Expect = e-109
 Identities = 188/450 (41%), Positives = 286/450 (62%), Gaps = 3/450 (0%)
 Frame = +3

Query: 153  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK 332
            MRE + I  GQ G Q+G   WE+ C EHGI   G+  GD  +    +  N +++E   G+
Sbjct: 1    MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSDLQL--ERINVYYNEASGGR 58

Query: 333  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD 512
             VPRAV +DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT G E++D  LD
Sbjct: 59   FVPRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLD 118

Query: 513  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS 692
             +RK A+NC  LQGF V +++GGGTGSG+G+LL+ ++  +Y  +  L F+V+PSP+VS +
Sbjct: 119  VVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDT 178

Query: 693  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTA 872
            VVEPYN+ LS H L+E+ D  ++LDNEA+YDIC R+L +  PT+ +LN L+S  +S +T 
Sbjct: 179  VVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLNHLISATMSGVTC 238

Query: 873  SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS 1052
             LRF G LN D+ +   NL+P+PR+HF +  +AP+ S     +  L+V E+T   ++  +
Sbjct: 239  CLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKN 298

Query: 1053 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP 1232
            MM   DPRHG+Y+    M+RG +  K+V+  +  ++ K +  FV+W P   K  +   PP
Sbjct: 299  MMCAADPRHGRYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSSVCDIPP 358

Query: 1233 SVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 1412
            +         ++ A   I NSTS+ E+F R+  +F  M+ ++AF+HWY GEGM+E EF+E
Sbjct: 359  N--------GLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTE 410

Query: 1413 AR---EDLAALEKDYEEVGAEFDEGEDGDEGDE 1502
            A     DL A  + Y++  A+ +E + GDE ++
Sbjct: 411  AESNMNDLVAEYQQYQDATADDEEEDYGDEEED 443
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 120044996 Number of Sequences: 59712 Number of extensions: 3960988 Number of successful extensions: 52730 Number of sequences better than 1.0e-10: 28 Number of HSP's better than 0.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 52690 Number of HSP's gapped (non-prelim): 17 length of query: 567 length of database: 26,991,925 effective HSP length: 52 effective length of query: 514 effective length of database: 23,886,901 effective search space: 12277867114 effective search space used: 12277867114 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG91   Members:150            3pri:Y   1e-121     
P36183           ENDOPLASMIN HOMOLOG PRECURSOR (GRP94 HOMOLOG)
pir||S33533 heat shock protein 90 homolog precursor - barley
         (2929 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9634.m04916|protein  Hsp90 protein, putative                   1427  0.0
 9636.m03953|protein  Similar to heat shock protein 82           690  0.0
 9637.m02719|protein  Similar to heat shock protein 82           686  0.0
 9632.m00078|protein  Similar to heat shock protein HSP82 -...   682  0.0
 9637.m02656|protein  heat-shock protein, 82K, precursor - rye   623  e-178
 9636.m03832|protein  heat-shock protein, 82K, precursor - rye   610  e-174
 9636.m03831|protein  heat-shock protein, 82K, precursor - rye   610  e-174
 9636.m03952|protein  Similar to heat shock protein 82           606  e-173
 9640.m03211|protein  AC009176 putative heat-shock protein       595  e-169
 9637.m03067|protein  Similar to heat shock protein 90A          226  2e-58

  9634.m04916|protein  Hsp90 protein, putative
            Length = 818
            
 Score = 1427 bits (3654), Expect = 0.0
 Identities = 726/809 (89%), Positives = 766/809 (93%), Gaps = 30/809 (3%)
 Frame = +2

Query: 53   MRKWALSCALLLVLLL-TTLPDP--------------------------AKKLQVNAEES 151
            MRKWALS ALLL+LLL TTLPDP                          AKKLQVNA++S
Sbjct: 1    MRKWALSSALLLLLLLLTTLPDPGMSLSAPAAGGVISLVGFAATSICCNAKKLQVNADDS 60

Query: 152  SDEVGDFPKVEEKLGAVPHGLSTDSEVVQRESESISRKTLRNSAEKFEFQAEVSRLMDII 331
            +DE+ D PKVEEK+G VPHGLSTDSEVVQRE+ESISRKTLR+SAEKFEFQAEVSRLMDII
Sbjct: 61   TDELVDPPKVEEKIGGVPHGLSTDSEVVQREAESISRKTLRSSAEKFEFQAEVSRLMDII 120

Query: 332  INSLYSNKDIFLRELISNASDALDKIRFLALTDKEVMGEGDTAKLEIQIKLDKENKILSI 511
            INSLYSNKDIFLRELISNASDALDKIRFLALTDKEV+GEGDTAKLEIQIKLDKE KILSI
Sbjct: 121  INSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQIKLDKEKKILSI 180

Query: 512  RDRGVGMTKEDLIKNLGTIAKSGTSAFVEKMQTGGDLNLIGQFGVGFYSVYLVADYVEVV 691
            RDRG+                    AFVEKMQTGGDLNLIGQFGVGFYSVYLVADYVEV+
Sbjct: 181  RDRGI--------------------AFVEKMQTGGDLNLIGQFGVGFYSVYLVADYVEVI 220

Query: 692  SKHNDDKQYVWESKADGSFAISEDTWNEPLGRGTEIKLHLRDEAKEYLEEGKLKDLVKKY 871
            SKHNDDKQ+VWESKADGSFAISEDTWNEPLGRGTEI+LHLRDEAKEY+EE KLKDLVKKY
Sbjct: 221  SKHNDDKQHVWESKADGSFAISEDTWNEPLGRGTEIRLHLRDEAKEYVEEDKLKDLVKKY 280

Query: 872  SEFINFPIYLWATKEVDVEVPADEEESNE---EEESTTETTEEEETEDDEEKKPKTKTVK 1042
            SEFINFPIYLWATKEVDVEVPADE+ES+E   EEES+ E+TEEEETE+ EEKKPKTKTVK
Sbjct: 281  SEFINFPIYLWATKEVDVEVPADEDESSESSEEEESSPESTEEEETEESEEKKPKTKTVK 340

Query: 1043 ETTTEWELLNDMKAVWLRSPKEVTEEEYAKFYHSLAKDFGDDKPMSWSHFSAEGDVEFKA 1222
            ETTTEWELLND+KA+WLRSPKEVTEEEY KFYHSLAKDFGDDKP+SWSHF+AEGDVEFKA
Sbjct: 341  ETTTEWELLNDVKAIWLRSPKEVTEEEYTKFYHSLAKDFGDDKPLSWSHFTAEGDVEFKA 400

Query: 1223 LLFVPPKAPHDLYESYYNANKSNLKLYVRRVFISDEFDDLLPKYLSFLMGIVDSDTLPLN 1402
            LLFVPPKAPHDLYESYYN+NKSNLKLYVRRVFISDEFD+LLPKYLSFL G+VDSDTLPLN
Sbjct: 401  LLFVPPKAPHDLYESYYNSNKSNLKLYVRRVFISDEFDELLPKYLSFLKGLVDSDTLPLN 460

Query: 1403 VSREMLQQHSSLKTIKKKLIRKALDMIRKLAEEDPDEYSNKEKTDDEKSAMEEKKGQYAK 1582
            VSREMLQQHSSLKTIKKKLIRKALDMIRKLAEEDPDEYSNK+KTD+EKSAMEEKKGQYAK
Sbjct: 461  VSREMLQQHSSLKTIKKKLIRKALDMIRKLAEEDPDEYSNKDKTDEEKSAMEEKKGQYAK 520

Query: 1583 FWNEFGKSVKLGIIEDATNRNRLAKLLRFESSKSDGKLVSLDEYISRMKSGQKDIFYLTG 1762
            FWNEFGKSVKLGIIEDATNRNRLAKLLRFES+KS+GKL SLDEYISRMK GQKDIFY+TG
Sbjct: 521  FWNEFGKSVKLGIIEDATNRNRLAKLLRFESTKSEGKLASLDEYISRMKPGQKDIFYITG 580

Query: 1763 SSKEQLEKSPFLEQLTKKNYEVIYFTDPVDEYLMQYLMDYEDKKFQNVSKEGLKLGKDSK 1942
            SSKEQLEKSPFLE+LTKKNYEVIYFTDPVDEYLMQYLMDYEDKKFQNVSKEGLKLGKDSK
Sbjct: 581  SSKEQLEKSPFLERLTKKNYEVIYFTDPVDEYLMQYLMDYEDKKFQNVSKEGLKLGKDSK 640

Query: 1943 LKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQTL 2122
            LKDLKESFKELTDWWKKALDTE +DSVKISNRL +TPCVVVTSKYGWS+NMEKIMQ+QTL
Sbjct: 641  LKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSKYGWSANMEKIMQSQTL 700

Query: 2123 SDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLVYQTALMESGFNLP 2302
            SDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDS+SE LKQTA+LVYQTALMESGFNLP
Sbjct: 701  SDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALMESGFNLP 760

Query: 2303 DPKDFASSIYRSVQKSLDLSPDAAVEEEEEVEEPEVEEKESAKQEAEEPEHEQYDKDEL 2479
            DPKDFASSIYRSVQKSLDLSPDAAVEEEEEVEE EVEEKES+  + EE E   YDKDEL
Sbjct: 761  DPKDFASSIYRSVQKSLDLSPDAAVEEEEEVEEAEVEEKESSNIK-EEAEPSSYDKDEL 818
  9636.m03953|protein  Similar to heat shock protein 82
            Length = 699
            
 Score =  690 bits (1761), Expect = 0.0
 Identities = 350/725 (48%), Positives = 502/725 (68%), Gaps = 4/725 (0%)
 Frame = +2

Query: 269  LRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVMGE 448
            + +  E F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF +LTDK  +  
Sbjct: 1    MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA 60

Query: 449  GDTAKLEIQIKLDKENKILSIRDRGVGMTKEDLIKNLGTIAKSGTSAFVEKMQTGGDLNL 628
                +L I I  DK +  LSI D G+GMTK DL+ NLGTIA+SGT  F+E +  G D+++
Sbjct: 61   --QPELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSM 118

Query: 629  IGQFGVGFYSVYLVADYVEVVSKHNDDKQYVWESKADGSFAISEDTWNEPLGRGTEIKLH 808
            IGQFGVGFYS YLVA+ V V +KHNDD+QYVWES+A GSF ++ DT  E LGRGT+I L+
Sbjct: 119  IGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLY 178

Query: 809  LRDEAKEYLEEGKLKDLVKKYSEFINFPIYLWATKEVDVEVPADEEESNEEEESTTETTE 988
            L+D+  EYLEE +LKDL+KK+SEFI++PI LW  K  + E+  DE+E  EE++   E   
Sbjct: 179  LKDDQLEYLEERRLKDLIKKHSEFISYPISLWTEKTTEKEISDDEDE--EEKKDAEEGKV 236

Query: 989  EEETEDDEEKKPKTKTVKETTTEWELLNDMKAVWLRSPKEVTEEEYAKFYHSLAKDFGDD 1168
            E+  E+ EEK+ K K +KE + EW L+N  K +W+R P+E+T+EEYA FY SL  D+  +
Sbjct: 237  EDVDEEKEEKEKKKKKIKEVSHEWSLVNKQKPIWMRKPEEITKEEYAAFYKSLTNDW--E 294

Query: 1169 KPMSWSHFSAEGDVEFKALLFVPPKAPHDLYESYYNANKSNLKLYVRRVFISDEFDDLLP 1348
            + ++  HFS EG +EFKA+LFVP +AP DL+++    N  N+KLYVRRVFI D  ++L+P
Sbjct: 295  EHLAVKHFSVEGQLEFKAVLFVPKRAPFDLFDTRKKLN--NIKLYVRRVFIMDNCEELIP 352

Query: 1349 KYLSFLMGIVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRKLAEEDPDEYSNKE 1528
            ++LSF+ GIVDS+ LPLN+SREMLQQ+  LK I+K L++K +++  ++AE       NKE
Sbjct: 353  EWLSFVKGIVDSEDLPLNISREMLQQNKILKVIRKNLVKKCVELFFEIAE-------NKE 405

Query: 1529 KTDDEKSAMEEKKGQYAKFWNEFGKSVKLGIIEDATNRNRLAKLLRFESSKSDGKLVSLD 1708
                           Y KF+  F K++KLGI ED+TNRN++A+LLR+ S+KS  +L SL 
Sbjct: 406  --------------DYNKFYEAFSKNLKLGIHEDSTNRNKIAELLRYHSTKSGDELTSLK 451

Query: 1709 EYISRMKSGQKDIFYLTGSSKEQLEKSPFLEQLTKKNYEVIYFTDPVDEYLMQYLMDYED 1888
            +Y++RMK GQ DI+Y+TG SK+ +E SPFLE+L KK YEV+Y  D +DEY +  L ++E 
Sbjct: 452  DYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEG 511

Query: 1889 KKFQNVSKEGLKLGKD----SKLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPC 2056
            KK  + +KEGLKL +      + ++LKE F+ L    K+ L  + ++ V +S+R+ ++PC
Sbjct: 512  KKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKVIKEVLG-DKVEKVVVSDRVVDSPC 570

Query: 2057 VVVTSKYGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSE 2236
             +VT +YGW++NME+IM+AQ L D+S   YM  K+ +EINP + I++ELR +   D + +
Sbjct: 571  CLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMEELRKRADADKNDK 630

Query: 2237 GLKQTARLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSPDAAVEEEEEVEEPEVEE 2416
             +K    L+++TAL+ SGF+L DP  F S I+R ++  L +  D   E + ++   E + 
Sbjct: 631  SVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEDETAEADTDMPPLEDDA 690

Query: 2417 KESAKQEAE 2443
             ES  +E +
Sbjct: 691  GESKMEEVD 699
  9637.m02719|protein  Similar to heat shock protein 82
            Length = 699
            
 Score =  686 bits (1751), Expect = 0.0
 Identities = 348/725 (48%), Positives = 502/725 (69%), Gaps = 4/725 (0%)
 Frame = +2

Query: 269  LRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVMGE 448
            + +  E F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF +LTDK  +  
Sbjct: 1    MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA 60

Query: 449  GDTAKLEIQIKLDKENKILSIRDRGVGMTKEDLIKNLGTIAKSGTSAFVEKMQTGGDLNL 628
                +L I I  DK +  LSI D GVGMTK DL+ NLGTIA+SGT  F+E +  G D+++
Sbjct: 61   --QPELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSM 118

Query: 629  IGQFGVGFYSVYLVADYVEVVSKHNDDKQYVWESKADGSFAISEDTWNEPLGRGTEIKLH 808
            IGQFGVGFYS YLVA+ V V +KHNDD+QYVWES+A GSF ++ DT  E LGRGT+I L+
Sbjct: 119  IGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLY 178

Query: 809  LRDEAKEYLEEGKLKDLVKKYSEFINFPIYLWATKEVDVEVPADEEESNEEEESTTETTE 988
            L+D+  EYLEE +LKDLVKK+SEFI++PI LW  K  + E+  DE+E  EE++   E   
Sbjct: 179  LKDDQLEYLEERRLKDLVKKHSEFISYPISLWTEKTTEKEISDDEDE--EEKKDAEEGKV 236

Query: 989  EEETEDDEEKKPKTKTVKETTTEWELLNDMKAVWLRSPKEVTEEEYAKFYHSLAKDFGDD 1168
            E+  E+ EEK+ K K +KE + EW ++N  K +WLR P+E+T+EEYA FY SL  D+  +
Sbjct: 237  EDVDEEKEEKEKKKKKIKEVSHEWNVMNKQKPIWLRKPEEITKEEYAAFYKSLTNDW--E 294

Query: 1169 KPMSWSHFSAEGDVEFKALLFVPPKAPHDLYESYYNANKSNLKLYVRRVFISDEFDDLLP 1348
            + ++  HFS EG +EFKA+LFVP +AP DL+++     ++N+KLYVRRVFI D  ++L+P
Sbjct: 295  EHLAVKHFSVEGQLEFKAILFVPKRAPFDLFDT--RKKQNNIKLYVRRVFIMDNCEELIP 352

Query: 1349 KYLSFLMGIVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRKLAEEDPDEYSNKE 1528
            ++LSF+ GIVDS+ LPLN+SREMLQQ+  LK I+K L++K +++  ++AE       NKE
Sbjct: 353  EWLSFVKGIVDSEDLPLNISREMLQQNKILKVIRKNLVKKCVELFFEIAE-------NKE 405

Query: 1529 KTDDEKSAMEEKKGQYAKFWNEFGKSVKLGIIEDATNRNRLAKLLRFESSKSDGKLVSLD 1708
                           Y KF+  F K++KLGI ED+TNR ++A+LLR+ S+KS  +L SL 
Sbjct: 406  --------------DYNKFYEAFSKNLKLGIHEDSTNRTKIAELLRYHSTKSGDELTSLK 451

Query: 1709 EYISRMKSGQKDIFYLTGSSKEQLEKSPFLEQLTKKNYEVIYFTDPVDEYLMQYLMDYED 1888
            +Y++RMK GQ +I+Y+TG SK+ +E SPFLE+L KK YEV+Y  D +DEY +  L ++E 
Sbjct: 452  DYVTRMKEGQSEIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEG 511

Query: 1889 KKFQNVSKEGLKLGKD----SKLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPC 2056
            KK  + +KEGLKL +      + ++LKE F+ L    K+ L  + ++ V +S+R+ ++PC
Sbjct: 512  KKLVSATKEGLKLDESEDEKKRQEELKEKFEGLCKVIKEVLG-DKVEKVVVSDRVVDSPC 570

Query: 2057 VVVTSKYGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSE 2236
             +VT +YGW++NME+IM+AQ L D+S   YM  K+ +EINP + I+ ELR +   D + +
Sbjct: 571  CLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDK 630

Query: 2237 GLKQTARLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSPDAAVEEEEEVEEPEVEE 2416
             +K    L+++TAL+ SGF+L DP  F + I+R ++  L +  D + E + ++   E + 
Sbjct: 631  SVKDLVMLLFETALLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDESAEADADMPPLEDDA 690

Query: 2417 KESAKQEAE 2443
             ES  +E +
Sbjct: 691  GESKMEEVD 699
  9632.m00078|protein  Similar to heat shock protein HSP82 - maize
            Length = 703
            
 Score =  682 bits (1742), Expect = 0.0
 Identities = 344/721 (47%), Positives = 498/721 (68%)
 Frame = +2

Query: 284  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVMGEGDTAK 463
            E F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF +LTDK  +      +
Sbjct: 13   ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA--QPE 70

Query: 464  LEIQIKLDKENKILSIRDRGVGMTKEDLIKNLGTIAKSGTSAFVEKMQTGGDLNLIGQFG 643
            L I++   K +K LSI D GVGMTK DL+ NLGTIA+SGT  F+E +Q G D+++IGQFG
Sbjct: 71   LFIRLVPYKPSKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGADVSMIGQFG 130

Query: 644  VGFYSVYLVADYVEVVSKHNDDKQYVWESKADGSFAISEDTWNEPLGRGTEIKLHLRDEA 823
            VGFYS YLVA+ V V +KHNDD+QYVWES+A GSF ++ DT  E LGRGT+I L L+D+ 
Sbjct: 131  VGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTLDTAGERLGRGTKITLFLKDDQ 190

Query: 824  KEYLEEGKLKDLVKKYSEFINFPIYLWATKEVDVEVPADEEESNEEEESTTETTEEEETE 1003
             EYLEE +LKDLVKK+SEFI++PIYLW+ K  + E+  DE++  ++ +   +  + EE +
Sbjct: 191  LEYLEERRLKDLVKKHSEFISYPIYLWSEKTTEKEISDDEDDDIDDSKGKEKEGDIEEVK 250

Query: 1004 DDEEKKPKTKTVKETTTEWELLNDMKAVWLRSPKEVTEEEYAKFYHSLAKDFGDDKPMSW 1183
            D    K K K V E + EW  +N  K +WLR P+E++ EEYA FY SL  D+ D   ++ 
Sbjct: 251  D----KKKKKKVNEVSHEWVQINKQKPIWLRKPEEISREEYASFYKSLTNDWEDH--LAV 304

Query: 1184 SHFSAEGDVEFKALLFVPPKAPHDLYESYYNANKSNLKLYVRRVFISDEFDDLLPKYLSF 1363
             HFS EG +EFKA+LFVP +AP DL+++    N  N+KLYVRRVFI D  ++L+P++L F
Sbjct: 305  KHFSVEGQLEFKAILFVPRRAPFDLFDTRKKMN--NIKLYVRRVFIMDNCEELIPEWLGF 362

Query: 1364 LMGIVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRKLAEEDPDEYSNKEKTDDE 1543
            + G+VDSD LPLN+SREMLQQ+  LK I+K L++K ++M  ++A+       NKE     
Sbjct: 363  VKGVVDSDDLPLNISREMLQQNKILKVIRKNLVKKCIEMFFEIAD-------NKE----- 410

Query: 1544 KSAMEEKKGQYAKFWNEFGKSVKLGIIEDATNRNRLAKLLRFESSKSDGKLVSLDEYISR 1723
                      YAKF+  F K++KLGI ED+ NR +LA LLR+ S+KS  +L SL +Y++R
Sbjct: 411  ---------DYAKFYEAFSKNLKLGIHEDSQNRGKLADLLRYHSTKSGNELTSLKDYVTR 461

Query: 1724 MKSGQKDIFYLTGSSKEQLEKSPFLEQLTKKNYEVIYFTDPVDEYLMQYLMDYEDKKFQN 1903
            MK GQK+++Y+TG S++ +E SPFLE+L KK YEV++  D +DEY +  L +Y+ KK  +
Sbjct: 462  MKEGQKEVYYITGESRKAVENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEYDGKKLVS 521

Query: 1904 VSKEGLKLGKDSKLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSKYGW 2083
             +KEGLKL  D   K+ K SF+ L    K  L  + ++ V +S+R+ ++PC +VT +YGW
Sbjct: 522  ATKEGLKLDDDDDAKERKRSFEPLCKVIKDILG-DRVEKVVVSDRIVDSPCCLVTGEYGW 580

Query: 2084 SSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLV 2263
            ++NME+IM+AQ L D+S  AYM  K+ +EINP + I++ELR +   D++ + ++    L+
Sbjct: 581  TANMERIMKAQALRDSSMGAYMSSKKTMEINPENGIMEELRKRADADANDKSVRDLVLLL 640

Query: 2264 YQTALMESGFNLPDPKDFASSIYRSVQKSLDLSPDAAVEEEEEVEEPEVEEKESAKQEAE 2443
            ++TAL+ SGF+L DP  FA+ I+R ++  L++  D A   +++ + P +++  + + + E
Sbjct: 641  FETALLTSGFSLDDPNTFAARIHRMLKLGLNIDDDDAAAADDDADMPALDDAAAEESKME 700

Query: 2444 E 2446
            E
Sbjct: 701  E 701
  9637.m02656|protein  heat-shock protein, 82K, precursor - rye
            Length = 791
            
 Score =  623 bits (1590), Expect = e-178
 Identities = 340/732 (46%), Positives = 482/732 (65%), Gaps = 13/732 (1%)
 Frame = +2

Query: 278  SAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVMGEGDT 457
            + E+FE+QAEVSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFL++TD  V+ +G  
Sbjct: 81   AGEQFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTDSSVLSDG-- 138

Query: 458  AKLEIQIKLDKENKILSIRDRGVGMTKEDLIKNLGTIAKSGTSAFV----EKMQTGGDLN 625
             +LEI+IK D E   ++I D G+GMTK++L   LGTIA+SGTS F+    E    G D  
Sbjct: 139  GELEIRIKPDPEAGTITITDTGIGMTKDELKDCLGTIAQSGTSKFLKALKENKDLGADNG 198

Query: 626  LIGQFGVGFYSVYLVADYVEVVSKH-NDDKQYVWESKADGS-FAISEDTWNEP-LGRGTE 796
            LIGQFGVGFYS +LVA+ V V +K    DKQYVWE+ AD S + I E+T  E  L RGT+
Sbjct: 199  LIGQFGVGFYSAFLVAEKVVVSTKSPKADKQYVWEAMADSSSYVIKEETDPEKMLTRGTQ 258

Query: 797  IKLHLRDEAK-EYLEEGKLKDLVKKYSEFINFPIYLWATKEVDVEVPADEEESNEEEEST 973
            I L LRD+ K E+ + G+++ LVK YS+F++FPIY W  K   VEV  +EEE  E EE+T
Sbjct: 259  ITLFLRDDDKYEFADPGRIQGLVKNYSQFVSFPIYTWQEKSRTVEV--EEEEPKEGEEAT 316

Query: 974  TETTEEEETEDDEEKKPKTKTVKETTTEWELLNDMKAVWLRSPKEVTEEEYAKFYHSLAK 1153
                       + EKK K KT+ E   +WEL N+ K +W+R+PKEV + EY +FY     
Sbjct: 317  -----------EGEKKKKKKTITEKYWDWELANETKPIWMRNPKEVEKTEYNEFYKKAFN 365

Query: 1154 DFGDDKPMSWSHFSAEGDVEFKALLFVPPKAPHDLYESYYNANKSNLKLYVRRVFISDEF 1333
            +F D  P++++HF+ EG+VEF+++L++P  AP    E   N    N++LYV+RVFISD+F
Sbjct: 366  EFLD--PLAYTHFTTEGEVEFRSVLYIPGMAPLS-NEEIMNPKTKNIRLYVKRVFISDDF 422

Query: 1334 D-DLLPKYLSFLMGIVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRKLAEEDPD 1510
            D +L P+YLSF+ G+VDS+ LPLNVSRE+LQ+   ++ ++K+L+RK  DMI+++AE+   
Sbjct: 423  DGELFPRYLSFVKGVVDSNDLPLNVSREILQESRIVRIMRKRLVRKTFDMIQEIAEK--- 479

Query: 1511 EYSNKEKTDDEKSAMEEKKGQYAKFWNEFGKSVKLGIIEDATNRNRLAKLLRFESSKSDG 1690
                            E K  Y KFW  FGK VKLG IED  N  RLA LLRF SSK++ 
Sbjct: 480  ----------------EDKEDYKKFWESFGKFVKLGCIEDTGNHKRLAPLLRFYSSKNET 523

Query: 1691 KLVSLDEYISRMKSGQKDIFYLTGSSKEQLEKSPFLEQLTKKNYEVIYFTDPVDEYLMQY 1870
             L+SLD+Y+  M   QK I+Y+   S +  + +PFLE+L +K+ EV+Y  +P+DE  +Q 
Sbjct: 524  DLISLDQYVENMPENQKAIYYIATDSLQSAKTAPFLEKLVQKDIEVLYLIEPIDEVAIQN 583

Query: 1871 LMDYEDKKFQNVSKEGLKLG--KDSKLKDLKESFKELTDWWKKALDTEGIDSVKISNRLH 2044
            L  Y++KKF ++SKE L+LG   + K  + K+ +  L DW K+ L  + +  V+ISNRL 
Sbjct: 584  LQTYKEKKFVDISKEDLELGDEDEDKENESKQEYTLLCDWIKQQLG-DKVAKVQISNRLS 642

Query: 2045 NTPCVVVTSKYGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQD 2224
            ++PCV+V+ K+GWS+NME++M+AQTL D S   +MRG+R+ EINP HPI+K+L      +
Sbjct: 643  SSPCVLVSGKFGWSANMERLMKAQTLGDTSSLEFMRGRRIFEINPDHPIVKDLSAACKNE 702

Query: 2225 SDSEGLKQTARLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSPDAAVEEEEEVEEP 2404
             +S   K+   L+Y+TAL+ SG+    P +    IY  +  +L        E E    E 
Sbjct: 703  PESTEAKRAVELLYETALISSGYTPDSPAELGGKIYEMMTIALGGRWGRPEESEAATSES 762

Query: 2405 --EVEEKESAKQEAEEPEHEQYDKD 2473
              EVE  E +  E  EP   + + D
Sbjct: 763  NVEVESSEGSATEVVEPSEVRPESD 787
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 180740190 Number of Sequences: 59712 Number of extensions: 5612884 Number of successful extensions: 125529 Number of sequences better than 1.0e-10: 20 Number of HSP's better than 0.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 125405 Number of HSP's gapped (non-prelim): 23 length of query: 976 length of database: 26,991,925 effective HSP length: 54 effective length of query: 921 effective length of database: 23,767,477 effective search space: 21889846317 effective search space used: 21889846317 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 163 (67.9 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG107   Members:97             3pri:Y   .068        
NP_702115.1      hypothetical protein [Plasmodium falciparum 3D7]
gb|AAN36839.1|AE014819_50 hypothetical protein [Plasmodium fa
         (541 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

 ***** No hits found ******

  Database: all.pep
    Posted date:  Nov 22, 2004 11:49 AM
  Number of letters in database: 26,991,925
  Number of sequences in database:  59,712
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 32733806
Number of Sequences: 59712
Number of extensions: 873249
Number of successful extensions: 10589
Number of sequences better than 1.0e-10: 0
Number of HSP's better than  0.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 10589
Number of HSP's gapped (non-prelim): 0
length of query: 180
length of database: 26,991,925
effective HSP length: 49
effective length of query: 130
effective length of database: 24,066,037
effective search space: 3128584810
effective search space used: 3128584810
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 155 (64.8 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG116   Members:329            3pri:Y   2e-46       
S53050           RNA binding protein - barley emb|CAA88558.1| glycine
rich protein, RNA binding protein [Hordeum vulgare subsp.
         (1004 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9631.m04543|protein  retrotransposon protein, putative, Ty...   261  1e-69
 9640.m04293|protein  Similar to glycine-rich RNA-binding p...   259  7e-69
 9631.m04544|protein  retrotransposon protein, putative, Ty...   210  3e-54
 9640.m03081|protein  Similar to RNA-binding protein - wood...   209  7e-54
 9635.m04113|protein  Similar to 162587 RNA-binding glycine...   160  3e-39
 9630.m01170|protein  RNA recognition motif. (a.k.a. RRM, R...   152  1e-36
 9631.m06121|protein  putative RNA binding protein               150  3e-36
 9629.m06835|protein  Similar to glycine-rich RNA-binding p...   138  2e-32
 9634.m03521|protein  RNA recognition motif. (a.k.a. RRM, R...   137  3e-32
 9634.m03520|protein  RNA recognition motif. (a.k.a. RRM, R...   137  3e-32
 9635.m00854|protein  RNA recognition motif. (a.k.a. RRM, R...   131  2e-30
 9634.m04025|protein  transposon protein, putative, CACTA, ...   123  5e-28
 9634.m02079|protein  expressed protein                          122  1e-27
 9634.m02081|protein  expressed protein                          122  1e-27
 9635.m03216|protein  transposon protein, putative, CACTA, ...   119  7e-27
 9635.m04941|protein  transposon protein, putative, CACTA, ...   119  7e-27
 9629.m00638|protein  transposon protein, putative, CACTA, ...   119  9e-27
 9629.m00637|protein  transposon protein, putative, CACTA, ...   119  9e-27
 9629.m00636|protein  transposon protein, putative, CACTA, ...   119  9e-27
 9635.m03213|protein  transposon protein, putative, CACTA, ...   118  2e-26

  9631.m04543|protein  retrotransposon protein, putative, Ty1-copia
           sub-class
           Length = 162
           
 Score =  261 bits (660), Expect = 1e-69
 Identities = 130/173 (75%), Positives = 139/173 (80%), Gaps = 3/173 (1%)
 Frame = +2

Query: 137 ETEYRCFVGGLAWATDDHNLQAAFSQYGEILDAKIINDRETGRSRGFGFVTFGSEESMRQ 316
           + EYRCFVGGLAWATDD +L+AAFS YGEILD+KIINDRETGRSRGFGFVTF SE+SMR 
Sbjct: 5   DVEYRCFVGGLAWATDDRSLEAAFSTYGEILDSKIINDRETGRSRGFGFVTFSSEQSMRD 64

Query: 317 AIEEMNGKELDGRSITVNEAQSRRSGGGGGGGGGYGGQRGGGGGYGGGGGYGGQGGGYGG 496
           AIE MNGKELDGR+ITVNEAQSRRSGGGGGG GG            GGGGYGG      G
Sbjct: 65  AIEGMNGKELDGRNITVNEAQSRRSGGGGGGYGG------------GGGGYGG------G 106

Query: 497 QGGGGYGGQGGGGYGGQRGGGGGYGGGGGGYGGGGGGYGGQRG---GGDSGGQWRS 655
           +GGGGYGG GGGGYG + GG GG GG GGG GGGGGGYGG RG   GGDSGG WR+
Sbjct: 107 RGGGGYGGGGGGGYGRREGGYGGGGGYGGGRGGGGGGYGGSRGGGYGGDSGGNWRN 162
  9640.m04293|protein  Similar to glycine-rich RNA-binding protein -
           rice
           Length = 162
           
 Score =  259 bits (654), Expect = 7e-69
 Identities = 129/173 (74%), Positives = 141/173 (80%), Gaps = 1/173 (0%)
 Frame = +2

Query: 137 ETEYRCFVGGLAWATDDHNLQAAFSQYGEILDAKIINDRETGRSRGFGFVTFGSEESMRQ 316
           + EYRCFVGGLAWATDD +L+AAFS +GEIL++KIINDRETGRSRGFGFVTF SE++MR 
Sbjct: 5   DVEYRCFVGGLAWATDDRSLEAAFSTFGEILESKIINDRETGRSRGFGFVTFSSEQAMRD 64

Query: 317 AIEEMNGKELDGRSITVNEAQSRRSGGGGGGGGGYGGQRGGGGGYGGGGGY-GGQGGGYG 493
           AIE MNGKELDGR+ITVNEAQSRRSGGGGGGG    GQRGGGGGYGGGGGY GG GGGYG
Sbjct: 65  AIEGMNGKELDGRNITVNEAQSRRSGGGGGGG---YGQRGGGGGYGGGGGYGGGGGGGYG 121

Query: 494 GQGGGGYGGQGGGGYGGQRGGGGGYGGGGGGYGGGGGGYGGQRGGGDSGGQWRS 655
            +  GGYG  GGGGYGG RGGGGGYGGG            G RGGG+S G WR+
Sbjct: 122 QRREGGYG--GGGGYGGGRGGGGGYGGG-----------YGSRGGGNSDGNWRN 162
  9631.m04544|protein  retrotransposon protein, putative, Ty1-copia
           sub-class
           Length = 196
           
 Score =  210 bits (530), Expect = 3e-54
 Identities = 108/153 (70%), Positives = 116/153 (75%)
 Frame = +2

Query: 137 ETEYRCFVGGLAWATDDHNLQAAFSQYGEILDAKIINDRETGRSRGFGFVTFGSEESMRQ 316
           + EYRCFVGGLAWATDD +L+AAFS YGEILD+KIINDRETGRSRGFGFVTF SE+SMR 
Sbjct: 5   DVEYRCFVGGLAWATDDRSLEAAFSTYGEILDSKIINDRETGRSRGFGFVTFSSEQSMRD 64

Query: 317 AIEEMNGKELDGRSITVNEAQSRRSGGGGGGGGGYGGQRGGGGGYGGGGGYGGQGGGYGG 496
           AIE MNGKELDGR+ITVNEAQSRRSGGGGGG G      GGGGGYGGG G    GGGYGG
Sbjct: 65  AIEGMNGKELDGRNITVNEAQSRRSGGGGGGYG------GGGGGYGGGRG----GGGYGG 114

Query: 497 QGGGGYGGQGGGGYGGQRGGGGGYGGGGGGYGG 595
            GGGGYG + GG            G GG  + G
Sbjct: 115 GGGGGYGRREGGYAVAAATAATPAGTGGTDWWG 147
  9640.m03081|protein  Similar to RNA-binding protein - wood tobacco
           Length = 258
           
 Score =  209 bits (526), Expect = 7e-54
 Identities = 107/165 (64%), Positives = 126/165 (75%), Gaps = 22/165 (13%)
 Frame = +2

Query: 149 RCFVGGLAWATDDHNLQAAFSQYGEILDAKIINDRETGRSRGFGFVTFGSEESMRQAIEE 328
           + FVGGL++ TD+ +L+  F+ YG++++AKIINDRETGRSRGFGF+T+ S E    AI  
Sbjct: 32  KLFVGGLSYGTDEQSLRDTFANYGQVIEAKIINDRETGRSRGFGFITYASSEEASAAITA 91

Query: 329 MNGKELDGRSITVNEAQSR----RSGGGGGGGGGYGGQRG--GGGGYGGGGGYGGQGGGY 490
           ++GK+LDGR+I VN A  R    RSGGGG GGGGYGG  G  GGGGY GGGGYGG G   
Sbjct: 92  LDGKDLDGRNIRVNTANERTGGFRSGGGGYGGGGYGGGGGGYGGGGYSGGGGYGGGGYSG 151

Query: 491 GGQGGGGYGGQGGGGYGGQRGGGGGYGGGGGGYG--------------GGGGGYGGQRGG 628
           GG GGGGY G GGGGYGG  GG G  GGGGGGYG              GG G +GG   G
Sbjct: 152 GGGGGGGYQG-GGGGYGGNNGGYGNRGGGGGGYGVAEGSADAFSGINLGGDGSFGGNPAG 210

Query: 629 --GDSGG 643
             GD+GG
Sbjct: 211 SFGDAGG 217
  9635.m04113|protein  Similar to 162587 RNA-binding glycine rich
           protein
           Length = 474
           
 Score =  160 bits (401), Expect = 3e-39
 Identities = 88/164 (53%), Positives = 111/164 (67%), Gaps = 41/164 (25%)
 Frame = +2

Query: 149 RCFVGGLAWATDDHNLQAAFSQYGEILDAKIINDRETGRSRGFGFVTFGSEESMRQAIEE 328
           + FVGGL++ATDD  L+  FS YG++L+A+II DR+TG+S+G+GF+T+ S E    A+  
Sbjct: 32  KLFVGGLSYATDDTTLKDVFSHYGDVLEARIIIDRDTGKSKGYGFITYTSSEEAAAAVTA 91

Query: 329 MNGKELDGRSITVNEAQSRRSGGGGGGGGGYGGQRGGGGGYGGGGGYG----GQGGGYGG 496
           M+GK+L GR + V+ A  R  G  GGGG G GG  G GGGY  GGGYG    G+GGGY G
Sbjct: 92  MDGKDLQGRIVRVSTANDRAGGIRGGGGFGAGGY-GSGGGYSSGGGYGTGEYGRGGGYAG 150

Query: 497 QGGGG-----YGGQGGGGYGGQ---------RGGGGGYGG-------------------- 574
            GG G     YGG G GGY             G  GGYG                     
Sbjct: 151 NGGYGGRASEYGGYGAGGYSSSGGYNATSVLHGNAGGYGSSGVSHGNAGDYRSSDVYNTT 210

Query: 575 ---GGGGYGGGGGGYGGQRGGGDSG 640
              G G +   GGG+G   GG +SG
Sbjct: 211 NTYGAGNFSHSGGGFGENSGGYNSG 235
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85593759 Number of Sequences: 59712 Number of extensions: 4705893 Number of successful extensions: 412161 Number of sequences better than 1.0e-10: 302 Number of HSP's better than 0.0 without gapping: 204 Number of HSP's successfully gapped in prelim test: 82 Number of HSP's that attempted gapping in prelim test: 366700 Number of HSP's gapped (non-prelim): 6982 length of query: 334 length of database: 26,991,925 effective HSP length: 51 effective length of query: 283 effective length of database: 23,946,613 effective search space: 6776891479 effective search space used: 6776891479 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG125   Members:66             3pri:Y   6e-65       
BAA96147.1       unnamed protein product [Oryza sativa (japonica
cultivar-group)] dbj|BAA96189.1| unnamed protein product [Oryz
         (990 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9629.m01079|protein  expressed protein                          262  8e-70
 9635.m00197|protein  hypothetical protein                       162  1e-39
 9635.m00199|protein  hypothetical protein                       160  4e-39
 9635.m00176|protein  expressed protein                          159  6e-39
 9635.m00201|protein  expressed protein                          156  5e-38
 9634.m03287|protein  Similar to susceptibility homeodomain...   156  5e-38
 9635.m00194|protein  expressed protein                          156  5e-38
 9639.m03467|protein  hypothetical protein                       155  1e-37
 9635.m00177|protein  hypothetical protein                       154  2e-37
 9635.m00196|protein  hypothetical protein                       154  2e-37
 9635.m00203|protein  expressed protein                          153  6e-37
 9639.m03468|protein  hypothetical protein                       152  7e-37
 9639.m03470|protein  expressed protein                          142  1e-33
 9640.m03657|protein  expressed protein                          131  2e-30
 9639.m04254|protein  AY101534 At1g56580/F25P12_18               126  5e-29
 9629.m04440|protein  hypothetical protein                       123  3e-28
 9633.m04678|protein  hypothetical protein                       119  7e-27
 9638.m03344|protein  hypothetical protein                       105  1e-22

  9629.m01079|protein  expressed protein
           Length = 167
           
 Score =  262 bits (662), Expect = 8e-70
 Identities = 130/156 (83%), Positives = 142/156 (90%), Gaps = 4/156 (2%)
 Frame = +2

Query: 188 AQAIEAQREGAEVYHGAALCAEKAVELLAETNMPLGLLPLADMEEVGYNRATGFVWLRQK 367
           +QAIEA REGAEVYHGAALCAEKAVELLAE +MPLGLLPLA+MEEVGYNRATGFVWLRQK
Sbjct: 3   SQAIEAHREGAEVYHGAALCAEKAVELLAEIHMPLGLLPLAEMEEVGYNRATGFVWLRQK 62

Query: 368 KALTHTFKQIGRQVSYATEVTAFVEDRKMKRMTGVKSKELLIWITLCDMFIDKDDPSKIT 547
           KA+THTFKQI RQVS+A EVTAFVEDR+MKR+TG K+KELLIW++L DMFIDKDD SKIT
Sbjct: 63  KAITHTFKQISRQVSFAAEVTAFVEDRRMKRVTGAKTKELLIWVSLSDMFIDKDDASKIT 122

Query: 548 FKTPTGLGRTFPVSAFEKKDDAK----ATAAAAGGKEAVV 655
           FKTPTGLGRT+PV AF K+DD K    A AAAA GKE  V
Sbjct: 123 FKTPTGLGRTYPVDAFAKEDDGKGKVPAAAAAANGKETAV 162
  9635.m00197|protein  hypothetical protein
           Length = 357
           
 Score =  162 bits (405), Expect = 1e-39
 Identities = 77/137 (56%), Positives = 103/137 (74%), Gaps = 1/137 (0%)
 Frame = +2

Query: 185 MAQAIEAQREGAEVYHGAALCAEKAVELLAETNMPLGLLPLADMEEVGYNRATGFVWLRQ 364
           MA  IE+ R GAE+ +G A+C +K++ELL E  +P GLLPL D+EE GYNR TGF+WL Q
Sbjct: 1   MASQIESHRSGAEIVNGDAICRKKSIELLEELGLPKGLLPLEDIEEFGYNRGTGFMWLVQ 60

Query: 365 KKA-LTHTFKQIGRQVSYATEVTAFVEDRKMKRMTGVKSKELLIWITLCDMFIDKDDPSK 541
           KK  + HTFK+I + VSYA EVTAF E  K+K++TGVK+KELL+W+++ +++I    P K
Sbjct: 61  KKKKIEHTFKKIKQTVSYANEVTAFTEKGKLKKITGVKTKELLLWLSVVEVYITDASPDK 120

Query: 542 ITFKTPTGLGRTFPVSAF 595
           +TFKT TGL  TF  +AF
Sbjct: 121 VTFKTGTGLSDTFDAAAF 138
  9635.m00199|protein  hypothetical protein
           Length = 142
           
 Score =  160 bits (400), Expect = 4e-39
 Identities = 76/137 (55%), Positives = 103/137 (74%), Gaps = 1/137 (0%)
 Frame = +2

Query: 185 MAQAIEAQREGAEVYHGAALCAEKAVELLAETNMPLGLLPLADMEEVGYNRATGFVWLRQ 364
           MA  IE+ R GAE+ +G A+C  K++ELL E  +P GLLPL D+EE GYNR TGF+WL Q
Sbjct: 1   MASQIESHRSGAEIINGDAICRNKSIELLEELGLPKGLLPLEDIEEFGYNRDTGFMWLVQ 60

Query: 365 -KKALTHTFKQIGRQVSYATEVTAFVEDRKMKRMTGVKSKELLIWITLCDMFIDKDDPSK 541
            KK + HTFK+I + VSYA EVTAFVE  K+K++ GVK+KELL+W+++ ++++ +  P K
Sbjct: 61  RKKKIEHTFKKIKQTVSYAGEVTAFVEKGKLKKIAGVKTKELLLWLSVVEVYVTEASPEK 120

Query: 542 ITFKTPTGLGRTFPVSAF 595
           +TFKT TGL  TF  +AF
Sbjct: 121 VTFKTGTGLSDTFDAAAF 138
  9635.m00176|protein  expressed protein
           Length = 142
           
 Score =  159 bits (399), Expect = 6e-39
 Identities = 77/137 (56%), Positives = 103/137 (74%), Gaps = 1/137 (0%)
 Frame = +2

Query: 185 MAQAIEAQREGAEVYHGAALCAEKAVELLAETNMPLGLLPLADMEEVGYNRATGFVWLRQ 364
           MA  IE  R GAEV +G A+C ++++ELL E  +P GLLPL D+EE GYNR TGF+WL Q
Sbjct: 1   MASQIENHRSGAEVVNGDAICRKRSIELLGELGLPKGLLPLEDIEEFGYNRDTGFMWLVQ 60

Query: 365 KKA-LTHTFKQIGRQVSYATEVTAFVEDRKMKRMTGVKSKELLIWITLCDMFIDKDDPSK 541
           KK  + HTFK+I + VSYA EVTAFVE  K+K++TGVK+KELL+W+++ ++++    P K
Sbjct: 61  KKKKIEHTFKKIKQTVSYAREVTAFVEKGKLKKITGVKTKELLLWLSVVEVYLADASPEK 120

Query: 542 ITFKTPTGLGRTFPVSAF 595
           +TFKT TGL  TF  +AF
Sbjct: 121 VTFKTGTGLSDTFDAAAF 138
  9635.m00201|protein  expressed protein
           Length = 142
           
 Score =  156 bits (391), Expect = 5e-38
 Identities = 74/137 (54%), Positives = 103/137 (75%), Gaps = 1/137 (0%)
 Frame = +2

Query: 185 MAQAIEAQREGAEVYHGAALCAEKAVELLAETNMPLGLLPLADMEEVGYNRATGFVWLRQ 364
           MA  IE+ R  AE+ +G A+C +K++ELL E  +P GLLPL D+EE GYNR TGF+W+ Q
Sbjct: 1   MASQIESHRASAEIVNGDAICRKKSIELLEELGLPKGLLPLEDIEEFGYNRDTGFMWMVQ 60

Query: 365 -KKALTHTFKQIGRQVSYATEVTAFVEDRKMKRMTGVKSKELLIWITLCDMFIDKDDPSK 541
            KK + HTFK+I + VSYA EVTAFVE  K+K++TGVK+KELL+W+++ ++++ +  P K
Sbjct: 61  RKKKIEHTFKKIKQTVSYAGEVTAFVEKGKLKKITGVKTKELLLWLSVVEVYVAEASPEK 120

Query: 542 ITFKTPTGLGRTFPVSAF 595
           +TFKT TGL   F  +AF
Sbjct: 121 VTFKTGTGLSDNFDATAF 138
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66729402 Number of Sequences: 59712 Number of extensions: 2295422 Number of successful extensions: 67237 Number of sequences better than 1.0e-10: 36 Number of HSP's better than 0.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 67196 Number of HSP's gapped (non-prelim): 25 length of query: 330 length of database: 26,991,925 effective HSP length: 51 effective length of query: 278 effective length of database: 23,946,613 effective search space: 6657158414 effective search space used: 6657158414 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG152   Members:15             3pri:Y   6e-41       
CAB65536.1       proline-rich protein [Zea mays]
         (962 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9638.m00510|protein  expressed protein                          245  1e-64
 9638.m00512|protein  expressed protein                          243  4e-64
 9638.m00513|protein  Similar to proline-rich protein            242  8e-64
 9638.m00511|protein  expressed protein                          236  4e-62
 9638.m00508|protein  expressed protein                          226  5e-59
 9638.m00499|protein  proline-rich protein, putative             192  6e-49
 9638.m00501|protein  proline-rich protein, putative             191  1e-48
 9638.m00495|protein  expressed protein                          190  2e-48
 9638.m00488|protein  expressed protein                          180  3e-45
 9638.m00506|protein  expressed protein                          180  4e-45
 9638.m00492|protein  expressed protein                          177  2e-44
 9638.m00504|protein  Putative proline-rich protein              166  4e-41
 9631.m01353|protein  expressed protein                          165  1e-40
 9638.m00497|protein  proline-rich protein, putative             157  3e-38
 9631.m01354|protein  expressed protein                          122  1e-27

  9638.m00510|protein  expressed protein
           Length = 224
           
 Score =  245 bits (618), Expect = 1e-64
 Identities = 136/193 (70%), Positives = 156/193 (80%), Gaps = 33/193 (17%)
 Frame = +2

Query: 29  APRALVLAVLLAVVFANA---EAASVVVGLAKCADCTRKNIKAQEAFKGLQVAVKCKNVH 199
           APR LVL  + AV+ A A   EAASVVVG AKCADCTRKN+KA++AFK LQVA+KCKN +
Sbjct: 4   APRGLVLLGVCAVLMAVAVGGEAASVVVGTAKCADCTRKNMKAEDAFKNLQVAIKCKNGN 63

Query: 200 GDYESKAVGALDSTGAFSVPLAADLHGADCVAQLHSAASNAPCPGQKPSKIVPVSEGTTF 379
           G+YESKA G LD TGAFSVPL ADLH +DC+AQLHSA +N PCPGQ+PSKIVP+SEGT F
Sbjct: 64  GEYESKATGKLDGTGAFSVPLDADLHSSDCIAQLHSA-TNEPCPGQEPSKIVPMSEGT-F 121

Query: 380 GIVAGDNVVMPSAASPECASMTLCGPIKKHIMEHFHHKKPVPPKPEPKPE-----PHPDN 544
             VAG         S  CAS+T+CGPIKK I++HFH KKPVPPKPEPKPE     P P++
Sbjct: 122 AAVAGKT----HYRSALCASVTICGPIKKKIIDHFH-KKPVPPKPEPKPEPPKPKPEPEH 176

Query: 545 ------------------------GPVPKPEPKPQPHPDYH-PVPP 607
                                    P PKPEPKPQP P+YH P PP
Sbjct: 177 PFLDHIHKKEKHFFDHFHKKPVPPKPEPKPEPKPQPAPEYHNPSPP 222
  9638.m00512|protein  expressed protein
           Length = 229
           
 Score =  243 bits (613), Expect = 4e-64
 Identities = 136/193 (70%), Positives = 155/193 (79%), Gaps = 37/193 (19%)
 Frame = +2

Query: 29  APRALVLAVLLAVVFANA---EAASVVVGLAKCADCTRKNIKAQEAFKGLQVAVKCKNVH 199
           APR LVL  + AV+ A A   EAASVVVG AKCADCTRKN+KA++AFK LQVA+KCKN +
Sbjct: 4   APRGLVLLGVCAVLMAVAVGGEAASVVVGTAKCADCTRKNMKAEDAFKNLQVAIKCKNTN 63

Query: 200 GDYESKAVGALDSTGAFSVPLAADLHGADCVAQLHSAASNAPCPGQKPSKIVPVSEGTTF 379
           G+YESKA G LD TGAFSVPL ADL  +DC+AQLHS A+N PCPGQ+PSKIVP+SEG TF
Sbjct: 64  GEYESKAAGKLDGTGAFSVPLDADLDSSDCIAQLHS-ANNEPCPGQEPSKIVPMSEG-TF 121

Query: 380 GIVAGDNVVMPSAASPECASMTLCGPIKKHIMEHFHHKKPVPPKPEPKPE---------- 529
             +AG     PSA    CAS T+CGPIKK I++HF HKKPVPPKPEPKPE          
Sbjct: 122 VAIAG-KTHYPSAL---CASATICGPIKKKIIDHF-HKKPVPPKPEPKPEPPKPKPEPEH 176

Query: 530 -----------------------PHPDNGPVPKPEPKPQPHPDYH-PVPP 607
                                  P P+  P PKPEPKPQP P+YH P PP
Sbjct: 177 PFLDHIHKKEKHFFDHFHKKPVPPKPEPKPEPKPEPKPQPAPEYHNPSPP 226
  9638.m00513|protein  Similar to proline-rich protein
           Length = 229
           
 Score =  242 bits (611), Expect = 8e-64
 Identities = 136/193 (70%), Positives = 154/193 (79%), Gaps = 37/193 (19%)
 Frame = +2

Query: 29  APRALVLAVLLAVVFANA---EAASVVVGLAKCADCTRKNIKAQEAFKGLQVAVKCKNVH 199
           APR LVL  + AV+ A A   EAASVVVG AKCADCTRKN+KA++AFK LQVA+KCKN +
Sbjct: 4   APRGLVLLGVCAVLMAVAVGGEAASVVVGTAKCADCTRKNMKAEDAFKNLQVAIKCKNGN 63

Query: 200 GDYESKAVGALDSTGAFSVPLAADLHGADCVAQLHSAASNAPCPGQKPSKIVPVSEGTTF 379
           G+YESKA G LD TG FS+PL ADLH +DCVAQLH  A+N PCPGQ+PSKIVP+SEG TF
Sbjct: 64  GEYESKATGKLDGTGVFSIPLDADLHSSDCVAQLH-GATNEPCPGQEPSKIVPMSEG-TF 121

Query: 380 GIVAGDNVVMPSAASPECASMTLCGPIKKHIMEHFHHKKPVPPKPEPKPE---------- 529
             VAG     PSA    CAS T+CGPIKK I++HF HKKPVPPKPEPKPE          
Sbjct: 122 IAVAG-QTHYPSAL---CASATICGPIKKKIIDHF-HKKPVPPKPEPKPEPPKPKPEPEH 176

Query: 530 -----------------------PHPDNGPVPKPEPKPQPHPDYH-PVPP 607
                                  P P+  P PKPEPKPQP P+YH P PP
Sbjct: 177 PFLDHIHKKEKHFFDHFHKKPVPPKPEPKPEPKPEPKPQPAPEYHNPSPP 226
  9638.m00511|protein  expressed protein
           Length = 229
           
 Score =  236 bits (596), Expect = 4e-62
 Identities = 129/193 (66%), Positives = 152/193 (77%), Gaps = 37/193 (19%)
 Frame = +2

Query: 29  APRALVL---AVLLAVVFANAEAASVVVGLAKCADCTRKNIKAQEAFKGLQVAVKCKNVH 199
           APR LVL     +L V+  + EAASVV+G AKCADCTRKN+KA++AFK LQVA+KCKN +
Sbjct: 4   APRGLVLLGVCAVLMVLAVSGEAASVVIGTAKCADCTRKNMKAEDAFKNLQVAIKCKNGN 63

Query: 200 GDYESKAVGALDSTGAFSVPLAADLHGADCVAQLHSAASNAPCPGQKPSKIVPVSEGTTF 379
           G+YESKA G LD +GAFSVPL  DLH +DC+AQLHS A+N PCPGQ+PSKIVP+SEG TF
Sbjct: 64  GEYESKAAGKLDGSGAFSVPLDTDLHSSDCIAQLHS-ATNEPCPGQEPSKIVPLSEG-TF 121

Query: 380 GIVAGDNVVMPSAASPECASMTLCGPIKKHIMEHFHHKKPVPPKPEPKPE---------- 529
             VAG      S  S  CAS T+CGPIKK I++HF HKKPVPPKP+PKPE          
Sbjct: 122 VTVAGKT----SYPSALCASATICGPIKKKIIDHF-HKKPVPPKPDPKPEPPKPKPEPEH 176

Query: 530 -----------------------PHPDNGPVPKPEPKPQPHPDYH-PVPP 607
                                  P P+    PKP+PKPQP P+YH P PP
Sbjct: 177 PILDHFHKKEKDFFDHFHKKPVPPKPEPKSEPKPQPKPQPAPEYHNPSPP 226
  9638.m00508|protein  expressed protein
           Length = 196
           
 Score =  226 bits (570), Expect = 5e-59
 Identities = 118/191 (61%), Positives = 136/191 (70%), Gaps = 4/191 (2%)
 Frame = +2

Query: 26  AAPRALVLAVLLAVVFANAEAASVVVGLAKCADCTRKNIKAQEAFKGLQVAVKCKN-VHG 202
           AA R L L  +L  V A+ EAASVVVGLAKC DCTRKN+KA+ AFKGL+VA+KCKN   G
Sbjct: 3   AAGRVLALLAVLMAVAAHGEAASVVVGLAKCGDCTRKNMKAKAAFKGLRVAIKCKNGADG 62

Query: 203 DYESKAVGALDSTGAFSVPLAADLHGADCVAQLHSAA-SNAPCPGQKPSKIVPVSEGTTF 379
           +YE+KA G LD  GAF VPLAADL GADCVAQLHSAA +NA CPGQ+PS+++ +SE  TF
Sbjct: 63  EYETKAAGKLDGAGAFRVPLAADLRGADCVAQLHSAAHNNAACPGQEPSRVMQLSE-RTF 121

Query: 380 GIVAGDNVVMPSAASPECASMTLCGPIKKHIMEHFHHKKPVP--PKPEPKPEPHPDNGPV 553
             VAG         SP CAS T+C PIKKH  +HFHH KP P  P  +P P+PHPD  P 
Sbjct: 122 VAVAGKT----HYVSPVCASATICEPIKKHFFDHFHHNKPAPAAPSTKPAPKPHPDQPPH 177

Query: 554 PKPEPKPQPHPDYHP 598
           PKP P       YHP
Sbjct: 178 PKPTPTYGTPSPYHP 192
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72841012 Number of Sequences: 59712 Number of extensions: 2790044 Number of successful extensions: 78773 Number of sequences better than 1.0e-10: 30 Number of HSP's better than 0.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 78507 Number of HSP's gapped (non-prelim): 72 length of query: 320 length of database: 26,991,925 effective HSP length: 51 effective length of query: 269 effective length of database: 23,946,613 effective search space: 6441638897 effective search space used: 6441638897 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG156   Members:65             3pri:Y   4e-43       
BAB78536.2       cold shock protein-1 [Triticum aestivum]
         (1023 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9636.m00267|protein  retrotransposon protein, putative, Ty...   323  3e-88
 9630.m00199|protein  Zinc knuckle, putative                     247  2e-65
 9629.m00638|protein  transposon protein, putative, CACTA, ...   142  1e-33
 9629.m00637|protein  transposon protein, putative, CACTA, ...   142  1e-33
 9629.m00636|protein  transposon protein, putative, CACTA, ...   142  1e-33
 9635.m04045|protein  transposon protein, putative, CACTA, ...   139  1e-32
 9635.m03216|protein  transposon protein, putative, CACTA, ...   129  1e-29
 9635.m03215|protein  transposon protein, putative, CACTA, ...   127  2e-29
 9634.m02079|protein  expressed protein                          123  4e-28
 9636.m00068|protein  transposon protein, putative, CACTA, ...   123  4e-28
 9631.m01941|protein  retrotransposon protein, putative, Ty...   122  8e-28
 9635.m04942|protein  transposon protein, putative, CACTA, ...   122  8e-28
 9634.m05009|protein  transposon protein, putative, CACTA, ...   122  8e-28
 9635.m03213|protein  transposon protein, putative, CACTA, ...   122  1e-27
 9635.m04941|protein  transposon protein, putative, CACTA, ...   122  1e-27
 9634.m04025|protein  transposon protein, putative, CACTA, ...   122  1e-27
 9638.m00204|protein  transposon protein, putative, CACTA, ...   122  1e-27
 9629.m00785|protein  transposon protein, putative, CACTA, ...   121  2e-27
 9635.m04943|protein  transposon protein, putative, CACTA, ...   120  5e-27
 9634.m00264|protein  transposon protein, putative, CACTA, ...   120  5e-27

  9636.m00267|protein  retrotransposon protein, putative, Ty1-copia
           sub-class
           Length = 197
           
 Score =  323 bits (819), Expect = 3e-88
 Identities = 149/199 (74%), Positives = 167/199 (83%)
 Frame = +3

Query: 63  ERVKGTVKWFNVTKGFGFISPEDGSDDLFVHQSAIKADGYRSLNENDVVEFDVITGDDGR 242
           ERVKGTVKWF+ TKGFGFI+P+DG +DLFVHQS++K+DGYRSLN+ DVVEF V +G+DGR
Sbjct: 4   ERVKGTVKWFDATKGFGFITPDDGGEDLFVHQSSLKSDGYRSLNDGDVVEFSVGSGNDGR 63

Query: 243 TKASDVTAPGGGALAGGSRPVDGGGDRGGRGGGGYGGGGYGGGGGGYGGGGGGYGGGGGG 422
           TKA DVTAPGGGAL GGSRP  GGGDRG  GG   GGGG  GG  GYGGGGGGYGGG  G
Sbjct: 64  TKAVDVTAPGGGALTGGSRP-SGGGDRGYGGG---GGGGRYGGDRGYGGGGGGYGGGDRG 119

Query: 423 YGSGGGGGRYGGGGGGRECYKCGEEGHISRDCPQGGGGGGGGGYGGGGGRGGGGGGGGGG 602
           YG GGG G  GGGGG R CYKCGEEGH++RDC QGGGGGGG G GGGG RGGGGGGGGGG
Sbjct: 120 YGGGGGYGG-GGGGGSRACYKCGEEGHMARDCSQGGGGGGGYGGGGGGYRGGGGGGGGGG 178

Query: 603 CFSCGESGHFSRECPNKAH 659
           C++CGE+GH +RECP+K +
Sbjct: 179 CYNCGETGHIARECPSKTY 197
  9630.m00199|protein  Zinc knuckle, putative
           Length = 241
           
 Score =  247 bits (625), Expect = 2e-65
 Identities = 132/193 (68%), Positives = 150/193 (77%), Gaps = 47/193 (24%)
 Frame = +3

Query: 66  RVKGTVKWFNVTKGFGFISPEDGSDDLFVHQSAIKADGYRSLNENDVVEFDVITGDDGRT 245
           R +GTVKWFN TKGFGFISP+DGS+DLFVHQS+IKADG+RSL E + VEF +   +DGRT
Sbjct: 6   RHRGTVKWFNDTKGFGFISPDDGSEDLFVHQSSIKADGFRSLAEGEQVEFAISESEDGRT 65

Query: 246 KASDVTAPGGGALAGGSRPVDGGGDRGGRGGGGYGGGGYGGGGGGYGG--------GGGG 401
           KA DVT P G  + GG+    GGG  GG G G  GGGG GGGG  YGG        GGGG
Sbjct: 66  KAVDVTGPDGSFVKGGA----GGGGGGGGGFGSRGGGGSGGGGRSYGGSWGGGRRSGGGG 121

Query: 402 YGGG----------------GGGYGSGGGGGRYGGGGGGRECYKCGEEGHISRDCPQGGG 533
            GGG                GGG G GGGGG  GGGG G  C+KCGE GH++RDC   GG
Sbjct: 122 PGGGCFKCGESGHMARDCFNGGGVGVGGGGG--GGGGAGGGCFKCGEMGHMARDCFNSGG 179

Query: 534 GGGGGGYGGGGG----------------RGGGGGGGG--GG-----CFSCGESGHFSREC 644
           GGGGGG GGGGG                 GGGGGGGG  GG     C++CGE+GH +R+C
Sbjct: 180 GGGGGGGGGGGGACYNCGETGHLARDCYNGGGGGGGGRFGGGGDRSCYNCGEAGHIARDC 239
  9629.m00638|protein  transposon protein, putative, CACTA, En/Spm
           sub-class
           Length = 500
           
 Score =  142 bits (354), Expect = 1e-33
 Identities = 81/123 (65%), Positives = 83/123 (66%), Gaps = 27/123 (21%)
 Frame = +3

Query: 270 GGGALAGGSRPVDGGGDRGGRGGGGYGGGGYGGGGGGYGGGGGGY------GGGGGGYGS 431
           GG    GG R   GGG  GG  GGG  GGGYGGGGGGYGGGGGGY      GGGGGGYG 
Sbjct: 15  GGRGGGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGG 74

Query: 432 GGGGGRYGGG-GGGR--------------------ECYKCGEEGHISRDCPQGGGGGGGG 548
           GGGGGR GGG GGGR                    EC KCG           GGGGGGGG
Sbjct: 75  GGGGGRGGGGRGGGRDGDWVCPDPSCGNVNFARRTECNKCGAPSPAG-----GGGGGGGG 129

Query: 549 GYGGGGGRGGGGGGGGGGCFSCGESGHFSR 638
           GY   GG GGGG   GGG FS G  G ++R
Sbjct: 130 GYNKSGG-GGGGYNRGGGDFSSGGGGGYNR 158
 Score =  106 bits (262), Expect = 7e-23
 Identities = 58/88 (65%), Positives = 59/88 (66%), Gaps = 5/88 (5%)
 Frame = +3

Query: 339 GGYGGGGYGGGGGGYGGGGGG--Y---GGGGGGYGSGGGGGRYGGGGGGRECYKCGEEGH 503
           G YG   Y GG GG GGGGGG      GGGGGGYG GG GG YGGGGGG   Y  G  G+
Sbjct: 3   GSYGSDDYRGGYGGRGGGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGG---YGGGGGGY 59

Query: 504 ISRDCPQGGGGGGGGGYGGGGGRGGGGGGGGGG 602
                  G GGGGGGGYGGGGG G GGGG GGG
Sbjct: 60  GG----GGRGGGGGGGYGGGGGGGRGGGGRGGG 88
 Score = 98.7 bits (242), Expect = 2e-20
 Identities = 66/109 (60%), Positives = 68/109 (61%), Gaps = 45/109 (41%)
 Frame = +3

Query: 270 GGGALAGGSRPVDGGGDRGGRGGGGYGGG------------------------------- 356
           GGG   GG     GGG  GGRGGGG GGG                               
Sbjct: 60  GGGGRGGGGGGGYGGGGGGGRGGGGRGGGRDGDWVCPDPSCGNVNFARRTECNKCGAPSP 119

Query: 357 ---GYGGGGGGY---GGGGGGYGGGGGGYGSGGGGGRYGGGGGGRECYKCGEEGHISRDC 518
              G GGGGGGY   GGGGGGY  GGG + SGGGGG   GGG     Y  G  G  +   
Sbjct: 120 AGGGGGGGGGGYNKSGGGGGGYNRGGGDFSSGGGGGYNRGGGD----YNSGGRGGGT--- 172

Query: 519 PQGGGGGGGGGYGGGGG--------RGGGGGGGG 596
              GGGG GGGY  GGG        RGG GG GG
Sbjct: 173 ---GGGGRGGGYNRGGGDDRGFDDHRGGRGGYGG 203
 Score = 85.0 bits (207), Expect = 2e-16
 Identities = 53/104 (50%), Positives = 55/104 (51%), Gaps = 6/104 (5%)
 Frame = +3

Query: 288 GGSRPVDGGGDRGGRGGGGY-----GGGGYGGGGGGY-GGGGGGYGGGGGGYGSGGGGGR 449
           G   P  GGG   G GGGGY     GGGGY  GGG +  GGGGGY  GGG Y SGG GG 
Sbjct: 115 GAPSPAGGGG---GGGGGGYNKSGGGGGGYNRGGGDFSSGGGGGYNRGGGDYNSGGRGGG 171

Query: 450 YGGGGGGRECYKCGEEGHISRDCPQGGGGGGGGGYGGGGGRGGGGGGGGG 599
            GGGG G   Y  G       D  +GG GG GG   G   RG   G   G
Sbjct: 172 TGGGGRGGG-YNRGGGDDRGFDDHRGGRGGYGGRDQGNNQRGDESGYDAG 220
 Score = 76.9 bits (186), Expect = 6e-14
 Identities = 61/123 (49%), Positives = 66/123 (53%), Gaps = 43/123 (34%)
 Frame = +3

Query: 240 RTKASDVTAP-----GGGALAGGSRPVDGGGDRGGRGGGGY---GGGGYGGGGGGY---- 383
           RT+ +   AP     GGG   GG     GGG    RGGG +   GGGGY  GGG Y    
Sbjct: 108 RTECNKCGAPSPAGGGGGGGGGGYNKSGGGGGGYNRGGGDFSSGGGGGYNRGGGDYNSGG 167

Query: 384 -GGGGGGYGGGGGGYGSGGG---------GGRYGGGG--------GGRECYKCGEEGHIS 509
            GGG GG GG GGGY  GGG         GGR G GG        G    Y  G  G + 
Sbjct: 168 RGGGTGG-GGRGGGYNRGGGDDRGFDDHRGGRGGYGGRDQGNNQRGDESGYDAGSYGQVP 226

Query: 510 RDCPQGGGGGGG------GGYGGGGGRGGGGG-------GGGGGCF 608
              P   GG GG        YGG                GGG G +
Sbjct: 227 PQGPPSYGGPGGDYAAPPSSYGGNNAYNSDSAVPPPSSYGGGPGSY 272
 Score = 75.3 bits (182), Expect = 2e-13
 Identities = 61/115 (53%), Positives = 68/115 (59%), Gaps = 75/115 (65%)
 Frame = +3

Query: 255 DVTAPGGGALAGGSRPVDGGGDRGGRGGGGYGGGGYGGGG------------GGYGG--- 389
           D ++ GGG    G    + GG  GG GGGG GGG   GGG            GGYGG   
Sbjct: 147 DFSSGGGGGYNRGGGDYNSGGRGGGTGGGGRGGGYNRGGGDDRGFDDHRGGRGGYGGRDQ 206

Query: 390 ----------------------GGGGYGGGGGGYGS-----------------------G 434
                                 G   YGG GG Y +                       G
Sbjct: 207 GNNQRGDESGYDAGSYGQVPPQGPPSYGGPGGDYAAPPSSYGGNNAYNSDSAVPPPSSYG 266

Query: 435 GGGGRY--------------GGGGGGRECYKCGEEG-HISRDCPQGGGGGGGGGYGGGGG 569
           GG G Y              GG  GG+       +G +  R  P GGG G    Y GGGG
Sbjct: 267 GGPGSYPPSYGAPPPNPPYSGGAPGGQGSLPPSYDGGYGGRPMPGGGGPGAPPPYHGGGG 326

Query: 570 RGGGGGGGGG 599
            GGGGGGGGG
Sbjct: 327 GGGGGGGGGG 336
  9629.m00637|protein  transposon protein, putative, CACTA, En/Spm
           sub-class
           Length = 500
           
 Score =  142 bits (354), Expect = 1e-33
 Identities = 81/123 (65%), Positives = 83/123 (66%), Gaps = 27/123 (21%)
 Frame = +3

Query: 270 GGGALAGGSRPVDGGGDRGGRGGGGYGGGGYGGGGGGYGGGGGGY------GGGGGGYGS 431
           GG    GG R   GGG  GG  GGG  GGGYGGGGGGYGGGGGGY      GGGGGGYG 
Sbjct: 15  GGRGGGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGG 74

Query: 432 GGGGGRYGGG-GGGR--------------------ECYKCGEEGHISRDCPQGGGGGGGG 548
           GGGGGR GGG GGGR                    EC KCG           GGGGGGGG
Sbjct: 75  GGGGGRGGGGRGGGRDGDWVCPDPSCGNVNFARRTECNKCGAPSPAG-----GGGGGGGG 129

Query: 549 GYGGGGGRGGGGGGGGGGCFSCGESGHFSR 638
           GY   GG GGGG   GGG FS G  G ++R
Sbjct: 130 GYNKSGG-GGGGYNRGGGDFSSGGGGGYNR 158
 Score =  106 bits (262), Expect = 7e-23
 Identities = 58/88 (65%), Positives = 59/88 (66%), Gaps = 5/88 (5%)
 Frame = +3

Query: 339 GGYGGGGYGGGGGGYGGGGGG--Y---GGGGGGYGSGGGGGRYGGGGGGRECYKCGEEGH 503
           G YG   Y GG GG GGGGGG      GGGGGGYG GG GG YGGGGGG   Y  G  G+
Sbjct: 3   GSYGSDDYRGGYGGRGGGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGG---YGGGGGGY 59

Query: 504 ISRDCPQGGGGGGGGGYGGGGGRGGGGGGGGGG 602
                  G GGGGGGGYGGGGG G GGGG GGG
Sbjct: 60  GG----GGRGGGGGGGYGGGGGGGRGGGGRGGG 88
 Score = 98.7 bits (242), Expect = 2e-20
 Identities = 66/109 (60%), Positives = 68/109 (61%), Gaps = 45/109 (41%)
 Frame = +3

Query: 270 GGGALAGGSRPVDGGGDRGGRGGGGYGGG------------------------------- 356
           GGG   GG     GGG  GGRGGGG GGG                               
Sbjct: 60  GGGGRGGGGGGGYGGGGGGGRGGGGRGGGRDGDWVCPDPSCGNVNFARRTECNKCGAPSP 119

Query: 357 ---GYGGGGGGY---GGGGGGYGGGGGGYGSGGGGGRYGGGGGGRECYKCGEEGHISRDC 518
              G GGGGGGY   GGGGGGY  GGG + SGGGGG   GGG     Y  G  G  +   
Sbjct: 120 AGGGGGGGGGGYNKSGGGGGGYNRGGGDFSSGGGGGYNRGGGD----YNSGGRGGGT--- 172

Query: 519 PQGGGGGGGGGYGGGGG--------RGGGGGGGG 596
              GGGG GGGY  GGG        RGG GG GG
Sbjct: 173 ---GGGGRGGGYNRGGGDDRGFDDHRGGRGGYGG 203
 Score = 85.0 bits (207), Expect = 2e-16
 Identities = 53/104 (50%), Positives = 55/104 (51%), Gaps = 6/104 (5%)
 Frame = +3

Query: 288 GGSRPVDGGGDRGGRGGGGY-----GGGGYGGGGGGY-GGGGGGYGGGGGGYGSGGGGGR 449
           G   P  GGG   G GGGGY     GGGGY  GGG +  GGGGGY  GGG Y SGG GG 
Sbjct: 115 GAPSPAGGGG---GGGGGGYNKSGGGGGGYNRGGGDFSSGGGGGYNRGGGDYNSGGRGGG 171

Query: 450 YGGGGGGRECYKCGEEGHISRDCPQGGGGGGGGGYGGGGGRGGGGGGGGG 599
            GGGG G   Y  G       D  +GG GG GG   G   RG   G   G
Sbjct: 172 TGGGGRGGG-YNRGGGDDRGFDDHRGGRGGYGGRDQGNNQRGDESGYDAG 220
 Score = 76.9 bits (186), Expect = 6e-14
 Identities = 61/123 (49%), Positives = 66/123 (53%), Gaps = 43/123 (34%)
 Frame = +3

Query: 240 RTKASDVTAP-----GGGALAGGSRPVDGGGDRGGRGGGGY---GGGGYGGGGGGY---- 383
           RT+ +   AP     GGG   GG     GGG    RGGG +   GGGGY  GGG Y    
Sbjct: 108 RTECNKCGAPSPAGGGGGGGGGGYNKSGGGGGGYNRGGGDFSSGGGGGYNRGGGDYNSGG 167

Query: 384 -GGGGGGYGGGGGGYGSGGG---------GGRYGGGG--------GGRECYKCGEEGHIS 509
            GGG GG GG GGGY  GGG         GGR G GG        G    Y  G  G + 
Sbjct: 168 RGGGTGG-GGRGGGYNRGGGDDRGFDDHRGGRGGYGGRDQGNNQRGDESGYDAGSYGQVP 226

Query: 510 RDCPQGGGGGGG------GGYGGGGGRGGGGG-------GGGGGCF 608
              P   GG GG        YGG                GGG G +
Sbjct: 227 PQGPPSYGGPGGDYAAPPSSYGGNNAYNSDSAVPPPSSYGGGPGSY 272
 Score = 75.3 bits (182), Expect = 2e-13
 Identities = 61/115 (53%), Positives = 68/115 (59%), Gaps = 75/115 (65%)
 Frame = +3

Query: 255 DVTAPGGGALAGGSRPVDGGGDRGGRGGGGYGGGGYGGGG------------GGYGG--- 389
           D ++ GGG    G    + GG  GG GGGG GGG   GGG            GGYGG   
Sbjct: 147 DFSSGGGGGYNRGGGDYNSGGRGGGTGGGGRGGGYNRGGGDDRGFDDHRGGRGGYGGRDQ 206

Query: 390 ----------------------GGGGYGGGGGGYGS-----------------------G 434
                                 G   YGG GG Y +                       G
Sbjct: 207 GNNQRGDESGYDAGSYGQVPPQGPPSYGGPGGDYAAPPSSYGGNNAYNSDSAVPPPSSYG 266

Query: 435 GGGGRY--------------GGGGGGRECYKCGEEG-HISRDCPQGGGGGGGGGYGGGGG 569
           GG G Y              GG  GG+       +G +  R  P GGG G    Y GGGG
Sbjct: 267 GGPGSYPPSYGAPPPNPPYSGGAPGGQGSLPPSYDGGYGGRPMPGGGGPGAPPPYHGGGG 326

Query: 570 RGGGGGGGGG 599
            GGGGGGGGG
Sbjct: 327 GGGGGGGGGG 336
  9629.m00636|protein  transposon protein, putative, CACTA, En/Spm
           sub-class
           Length = 500
           
 Score =  142 bits (354), Expect = 1e-33
 Identities = 81/123 (65%), Positives = 83/123 (66%), Gaps = 27/123 (21%)
 Frame = +3

Query: 270 GGGALAGGSRPVDGGGDRGGRGGGGYGGGGYGGGGGGYGGGGGGY------GGGGGGYGS 431
           GG    GG R   GGG  GG  GGG  GGGYGGGGGGYGGGGGGY      GGGGGGYG 
Sbjct: 15  GGRGGGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGG 74

Query: 432 GGGGGRYGGG-GGGR--------------------ECYKCGEEGHISRDCPQGGGGGGGG 548
           GGGGGR GGG GGGR                    EC KCG           GGGGGGGG
Sbjct: 75  GGGGGRGGGGRGGGRDGDWVCPDPSCGNVNFARRTECNKCGAPSPAG-----GGGGGGGG 129

Query: 549 GYGGGGGRGGGGGGGGGGCFSCGESGHFSR 638
           GY   GG GGGG   GGG FS G  G ++R
Sbjct: 130 GYNKSGG-GGGGYNRGGGDFSSGGGGGYNR 158
 Score =  106 bits (262), Expect = 7e-23
 Identities = 58/88 (65%), Positives = 59/88 (66%), Gaps = 5/88 (5%)
 Frame = +3

Query: 339 GGYGGGGYGGGGGGYGGGGGG--Y---GGGGGGYGSGGGGGRYGGGGGGRECYKCGEEGH 503
           G YG   Y GG GG GGGGGG      GGGGGGYG GG GG YGGGGGG   Y  G  G+
Sbjct: 3   GSYGSDDYRGGYGGRGGGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGG---YGGGGGGY 59

Query: 504 ISRDCPQGGGGGGGGGYGGGGGRGGGGGGGGGG 602
                  G GGGGGGGYGGGGG G GGGG GGG
Sbjct: 60  GG----GGRGGGGGGGYGGGGGGGRGGGGRGGG 88
 Score = 98.7 bits (242), Expect = 2e-20
 Identities = 66/109 (60%), Positives = 68/109 (61%), Gaps = 45/109 (41%)
 Frame = +3

Query: 270 GGGALAGGSRPVDGGGDRGGRGGGGYGGG------------------------------- 356
           GGG   GG     GGG  GGRGGGG GGG                               
Sbjct: 60  GGGGRGGGGGGGYGGGGGGGRGGGGRGGGRDGDWVCPDPSCGNVNFARRTECNKCGAPSP 119

Query: 357 ---GYGGGGGGY---GGGGGGYGGGGGGYGSGGGGGRYGGGGGGRECYKCGEEGHISRDC 518
              G GGGGGGY   GGGGGGY  GGG + SGGGGG   GGG     Y  G  G  +   
Sbjct: 120 AGGGGGGGGGGYNKSGGGGGGYNRGGGDFSSGGGGGYNRGGGD----YNSGGRGGGT--- 172

Query: 519 PQGGGGGGGGGYGGGGG--------RGGGGGGGG 596
              GGGG GGGY  GGG        RGG GG GG
Sbjct: 173 ---GGGGRGGGYNRGGGDDRGFDDHRGGRGGYGG 203
 Score = 85.0 bits (207), Expect = 2e-16
 Identities = 53/104 (50%), Positives = 55/104 (51%), Gaps = 6/104 (5%)
 Frame = +3

Query: 288 GGSRPVDGGGDRGGRGGGGY-----GGGGYGGGGGGY-GGGGGGYGGGGGGYGSGGGGGR 449
           G   P  GGG   G GGGGY     GGGGY  GGG +  GGGGGY  GGG Y SGG GG 
Sbjct: 115 GAPSPAGGGG---GGGGGGYNKSGGGGGGYNRGGGDFSSGGGGGYNRGGGDYNSGGRGGG 171

Query: 450 YGGGGGGRECYKCGEEGHISRDCPQGGGGGGGGGYGGGGGRGGGGGGGGG 599
            GGGG G   Y  G       D  +GG GG GG   G   RG   G   G
Sbjct: 172 TGGGGRGGG-YNRGGGDDRGFDDHRGGRGGYGGRDQGNNQRGDESGYDAG 220
 Score = 76.9 bits (186), Expect = 6e-14
 Identities = 61/123 (49%), Positives = 66/123 (53%), Gaps = 43/123 (34%)
 Frame = +3

Query: 240 RTKASDVTAP-----GGGALAGGSRPVDGGGDRGGRGGGGY---GGGGYGGGGGGY---- 383
           RT+ +   AP     GGG   GG     GGG    RGGG +   GGGGY  GGG Y    
Sbjct: 108 RTECNKCGAPSPAGGGGGGGGGGYNKSGGGGGGYNRGGGDFSSGGGGGYNRGGGDYNSGG 167

Query: 384 -GGGGGGYGGGGGGYGSGGG---------GGRYGGGG--------GGRECYKCGEEGHIS 509
            GGG GG GG GGGY  GGG         GGR G GG        G    Y  G  G + 
Sbjct: 168 RGGGTGG-GGRGGGYNRGGGDDRGFDDHRGGRGGYGGRDQGNNQRGDESGYDAGSYGQVP 226

Query: 510 RDCPQGGGGGGG------GGYGGGGGRGGGGG-------GGGGGCF 608
              P   GG GG        YGG                GGG G +
Sbjct: 227 PQGPPSYGGPGGDYAAPPSSYGGNNAYNSDSAVPPPSSYGGGPGSY 272
 Score = 75.3 bits (182), Expect = 2e-13
 Identities = 61/115 (53%), Positives = 68/115 (59%), Gaps = 75/115 (65%)
 Frame = +3

Query: 255 DVTAPGGGALAGGSRPVDGGGDRGGRGGGGYGGGGYGGGG------------GGYGG--- 389
           D ++ GGG    G    + GG  GG GGGG GGG   GGG            GGYGG   
Sbjct: 147 DFSSGGGGGYNRGGGDYNSGGRGGGTGGGGRGGGYNRGGGDDRGFDDHRGGRGGYGGRDQ 206

Query: 390 ----------------------GGGGYGGGGGGYGS-----------------------G 434
                                 G   YGG GG Y +                       G
Sbjct: 207 GNNQRGDESGYDAGSYGQVPPQGPPSYGGPGGDYAAPPSSYGGNNAYNSDSAVPPPSSYG 266

Query: 435 GGGGRY--------------GGGGGGRECYKCGEEG-HISRDCPQGGGGGGGGGYGGGGG 569
           GG G Y              GG  GG+       +G +  R  P GGG G    Y GGGG
Sbjct: 267 GGPGSYPPSYGAPPPNPPYSGGAPGGQGSLPPSYDGGYGGRPMPGGGGPGAPPPYHGGGG 326

Query: 570 RGGGGGGGGG 599
            GGGGGGGGG
Sbjct: 327 GGGGGGGGGG 336
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91144873 Number of Sequences: 59712 Number of extensions: 5551378 Number of successful extensions: 542209 Number of sequences better than 1.0e-10: 375 Number of HSP's better than 0.0 without gapping: 175 Number of HSP's successfully gapped in prelim test: 194 Number of HSP's that attempted gapping in prelim test: 458564 Number of HSP's gapped (non-prelim): 9037 length of query: 341 length of database: 26,991,925 effective HSP length: 51 effective length of query: 289 effective length of database: 23,946,613 effective search space: 6920571157 effective search space used: 6920571157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG177   Members:162            3pri:Y   1e-144      
Q43772           UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
(UDP-GLUCOSE PYROPHOSPHORYLASE) (UDPGP) (UGPASE)
         (2226 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9637.m03241|protein  UTP--glucose-1-phosphate uridylyltran...   870  0.0
 9630.m00161|protein  Similar to UDP-glucose pyrophosphorylase   622  e-178
 9629.m01582|protein  Similar to utp--glucose-1-phosphate u...   469  e-131
 9630.m02873|protein  ribosomal protein L29, putative            104  5e-22
 9632.m02915|protein  ribosomal protein L29, putative            104  6e-22
 9631.m03557|protein  putative protein kinase                     68  5e-11

  9637.m03241|protein  UTP--glucose-1-phosphate uridylyltransferase
            Length = 469
            
 Score =  870 bits (2224), Expect = 0.0
 Identities = 436/469 (92%), Positives = 451/469 (95%)
 Frame = +3

Query: 126  AVAADSKIDGLRDAVAKLGEISENEKAGFISLVSRYLSGEAEQIEWSKIQTPTDEVVVPY 305
            AV AD K++GLR A  KL +ISENEK+GFISLVSRYLSGEAEQIEWSKIQTPTDEVVVPY
Sbjct: 2    AVTADVKLEGLRAATDKLDQISENEKSGFISLVSRYLSGEAEQIEWSKIQTPTDEVVVPY 61

Query: 306  DTLAPPPEDLDAMKALLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIES 485
            DTL+  PEDL+  K LLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIES
Sbjct: 62   DTLSAAPEDLNETKKLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIES 121

Query: 486  LNKKYGCSVPLLLMNSFNTHDDTQKIVEKYSNSNIEIHTFNQSQYPRIVTEDFLPLPSKG 665
            LNKKYGC+VPLLLMNSFNTHDDTQKIVEKYSNSNIEIHTFNQSQYPRIVTEDFLPLPSKG
Sbjct: 122  LNKKYGCNVPLLLMNSFNTHDDTQKIVEKYSNSNIEIHTFNQSQYPRIVTEDFLPLPSKG 181

Query: 666  QTGKDGWYPPGHGDVFPSLNNSGKLDTLLSQGKEYVFVANSDNLGAIVDIKILNHLIHNQ 845
            +TGKDGWYPPGHGDVFPSLNNSGKLDTLL+QGKEYVFVANSDNLGAIVDIKILNHLIHNQ
Sbjct: 182  KTGKDGWYPPGHGDVFPSLNNSGKLDTLLAQGKEYVFVANSDNLGAIVDIKILNHLIHNQ 241

Query: 846  NEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVDEFKSIEKFKIFNTNNLWVN 1025
            NEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHV+EFKSIEKFKIFNTNNLWVN
Sbjct: 242  NEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVN 301

Query: 1026 LKAIKRLVDAEALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFEKAIGINVPRSRFLPVK 1205
            LKAIKRLV+AEALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFEKAIGINVPRSRFLPVK
Sbjct: 302  LKAIKRLVEAEALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFEKAIGINVPRSRFLPVK 361

Query: 1206 ATSDLLLVQSDLYTLVDGYVIRNPARVKPSNPSIELGPEFKKVANFLARFKSIPSIVELD 1385
            ATSDLLLVQSDLYTLVDG+VIRNPAR  PSNPSIELGPEFKKVANFLARFKSIPSIVELD
Sbjct: 362  ATSDLLLVQSDLYTLVDGFVIRNPARTNPSNPSIELGPEFKKVANFLARFKSIPSIVELD 421

Query: 1386 SLKVSGDVSFGSGVVLKGNVTIAAKAGVKLEIPDGAVLENKDINGPEDI 1532
            +LKVSGDV FGSGV LKG VTI AK+G KLEIPDGAVLENKDINGPED+
Sbjct: 422  TLKVSGDVWFGSGVTLKGKVTITAKSG-KLEIPDGAVLENKDINGPEDL 469
  9630.m00161|protein  Similar to UDP-glucose pyrophosphorylase
            Length = 389
            
 Score =  622 bits (1586), Expect = e-178
 Identities = 328/466 (70%), Positives = 354/466 (75%)
 Frame = +3

Query: 135  ADSKIDGLRDAVAKLGEISENEKAGFISLVSRYLSGEAEQIEWSKIQTPTDEVVVPYDTL 314
            AD K+  LR+AVA L +IS+NEK+GFISLV+RYLSGE E +EW+KI TPTDEVVVPYDTL
Sbjct: 2    ADEKLAKLREAVAGLSQISDNEKSGFISLVARYLSGEEEHVEWAKIHTPTDEVVVPYDTL 61

Query: 315  APPPEDLDAMKALLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIESLNK 494
            A PPEDL+  K LL+KL VLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIES   
Sbjct: 62   AAPPEDLEETKKLLNKLAVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIES--- 118

Query: 495  KYGCSVPLLLMNSFNTHDDTQKIVEKYSNSNIEIHTFNQSQYPRIVTEDFLPLPSKGQTG 674
                                                    QYPR+V ++FLP PSKG+T 
Sbjct: 119  ----------------------------------------QYPRVVADEFLPWPSKGKTC 138

Query: 675  KDGWYPPGHGDVFPSLNNSGKLDTLLSQGKEYVFVANSDNLGAIVDIKILNHLIHNQNEY 854
            KDGWYPPGHGD+FPSL NSGKLD LLSQ                                
Sbjct: 139  KDGWYPPGHGDIFPSLMNSGKLDLLLSQ-------------------------------- 166

Query: 855  CMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVDEFKSIEKFKIFNTNNLWVNLKA 1034
               VTPKTLADVKGGTLISYE +VQLLEIAQVPD HV+EFKSIEKFKIFNTNNLWVNLKA
Sbjct: 167  ---VTPKTLADVKGGTLISYEDKVQLLEIAQVPDAHVNEFKSIEKFKIFNTNNLWVNLKA 223

Query: 1035 IKRLVDAEALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFEKAIGINVPRSRFLPVKATS 1214
            IKRLV+A+ALKMEIIPNPKEVDGVKVLQLETAAGAAIRFF+ AIGINVPRSRFLPVKATS
Sbjct: 224  IKRLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDHAIGINVPRSRFLPVKATS 283

Query: 1215 DLLLVQSDLYTLVDGYVIRNPARVKPSNPSIELGPEFKKVANFLARFKSIPSIVELDSLK 1394
            DL LVQSDLYTLVDG+V RNPAR  PSNPSIELGPEFKKV  FL RFKSIPSIVELD+LK
Sbjct: 284  DLQLVQSDLYTLVDGFVTRNPARTNPSNPSIELGPEFKKVGCFLGRFKSIPSIVELDTLK 343

Query: 1395 VSGDVSFGSGVVLKGNVTIAAKAGVKLEIPDGAVLENKDINGPEDI 1532
            VSGDV FGS + LKG VTI A+ GVKLEIPDGAV+ENKDINGPED+
Sbjct: 344  VSGDVWFGSSITLKGKVTITAQPGVKLEIPDGAVIENKDINGPEDL 389
  9629.m01582|protein  Similar to utp--glucose-1-phosphate
            uridylyltransferase (ec 2.7.7.9) (udp-glucose
            pyrophosphorylase) (udpgp) (ugpase). [banana
            Length = 753
            
 Score =  469 bits (1193), Expect = e-131
 Identities = 270/464 (58%), Positives = 317/464 (68%), Gaps = 10/464 (2%)
 Frame = +3

Query: 117  AAAAVAADSKIDGLRDAVA-KLGEISENEKAGFISLVSRYL-SGEAEQIEWSKIQTPTDE 290
            AA+     S    L + VA KL   S+ +K  F+ LVSRYL   E E I+W+K++ PT E
Sbjct: 147  AASGATVPSVAATLSEMVARKLSVDSDEDKDSFMHLVSRYLIREEKEMIDWNKVERPTPE 206

Query: 291  VVVPYDTLAPPPEDLDAMKALLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIV 470
            +VVPYD+L   P D+  ++ LL+KL VLKLNGGLGTTM C  PK  IEVR+G TFLDL +
Sbjct: 207  MVVPYDSLVQAPRDIPEIRNLLNKLAVLKLNGGLGTTMECVAPKCTIEVRSGLTFLDLAI 266

Query: 471  IQIESLNKKYGCSVPLLLMNSFNTHDDTQKIVEKYSNSNIEIHTFNQSQYPRIVTEDFLP 650
            +Q E                          IVEKY+N  IEIHTFNQ++YPRI+TE FLP
Sbjct: 267  MQTE--------------------------IVEKYTN--IEIHTFNQNKYPRIITEKFLP 298

Query: 651  LPSKGQTGKDGWYPPGHGDVFPSLNNSGKLDTLLSQGKEYVFVANSDNLGAIVDIKI--- 821
            L S+G TG   WYPPGHGDVF SL  SG LDT+LSQGKEYVF+A+S+NLGA VDI+I   
Sbjct: 299  LSSEGSTGSHCWYPPGHGDVFFSLCKSGILDTMLSQGKEYVFIASSENLGATVDIEIESL 358

Query: 822  -----LNHLIHNQNEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVDEFKSIE 986
                 LNHLIHN+NEYCME                      LLEI QVP E+V       
Sbjct: 359  TSTEILNHLIHNKNEYCME----------------------LLEIFQVPYENV------- 389

Query: 987  KFKIFNTNNLWVNLKAIKRLVDAEALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFEKAI 1166
                F      VNLKAIKRLV AEALKMEIIPN KEVDGVKVLQLE  AG+AI+ FEKAI
Sbjct: 390  ---AFGYRR--VNLKAIKRLVKAEALKMEIIPNLKEVDGVKVLQLEKEAGSAIQCFEKAI 444

Query: 1167 GINVPRSRFLPVKATSDLLLVQSDLYTLVDGYVIRNPARVKPSNPSIELGPEFKKVANFL 1346
            G+ VPRSRFL VK TSDL L+ SDLY ++DG V RNPAR   +NP I+LGPEF+KV +FL
Sbjct: 445  GVTVPRSRFLAVKNTSDLFLILSDLYIVMDGTVTRNPARDNSTNPLIDLGPEFRKVDSFL 504

Query: 1347 ARFKSIPSIVELDSLKVSGDVSFGSGVVLKGNVTIAAKAGVKLEIPDGAVLENK 1508
             RFKSIPSIV LDSLK+SGDV FGS + LKG VTIAA+ G+KL+I DG+V +NK
Sbjct: 505  DRFKSIPSIVALDSLKISGDVWFGSRITLKGEVTIAAQLGLKLDILDGSVFDNK 558
  9630.m02873|protein  ribosomal protein L29, putative
            Length = 123
            
 Score =  104 bits (258), Expect = 5e-22
 Identities = 51/53 (96%), Positives = 51/53 (96%)
 Frame = -1

Query: 2226 EAYKNKKLLPLDLRPKKTRAIRRRLTKHQLSLKTEREKKREKYFPMRKYAIKA 2068
            EAYK K LLPLDLRPKKTRAIRRRLTKHQLSLKTEREKKREKYFPMRKYAIKA
Sbjct: 71   EAYKKKSLLPLDLRPKKTRAIRRRLTKHQLSLKTEREKKREKYFPMRKYAIKA 123
  9632.m02915|protein  ribosomal protein L29, putative
            Length = 123
            
 Score =  104 bits (257), Expect = 6e-22
 Identities = 50/53 (94%), Positives = 51/53 (95%)
 Frame = -1

Query: 2226 EAYKNKKLLPLDLRPKKTRAIRRRLTKHQLSLKTEREKKREKYFPMRKYAIKA 2068
            EAYK K LLPLDLRPKKTRAIRRRLTKHQLSLKTEREKKREKYFPMRKYA+KA
Sbjct: 71   EAYKKKSLLPLDLRPKKTRAIRRRLTKHQLSLKTEREKKREKYFPMRKYAVKA 123
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 145185580 Number of Sequences: 59712 Number of extensions: 4506031 Number of successful extensions: 89100 Number of sequences better than 1.0e-10: 12 Number of HSP's better than 0.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 88964 Number of HSP's gapped (non-prelim): 27 length of query: 742 length of database: 26,991,925 effective HSP length: 53 effective length of query: 688 effective length of database: 23,827,189 effective search space: 16393106032 effective search space used: 16393106032 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 162 (67.5 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG181   Members:15             3pri:Y   3e-88       
AAB65432.1       ADP-ribosylation factor 1 [Oryza sativa]
dbj|BAC06914.1| ADP-ribosylation factor 1 [Oryza sativa (japonica cul
         (1031 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9635.m01193|protein  ADP-ribosylation factor family, putative   369  e-102
 9635.m01196|protein  ADP-ribosylation factor family             366  e-101
 9633.m03842|protein  ADP-ribosylation factor [imported] - ...   362  e-100
 9631.m05882|protein  ADP-ribosylation factor                    361  e-100
 9631.m05881|protein  ADP-ribosylation factor                    361  e-100
 9629.m01594|protein  ADP-ribosylation factor family             359  4e-99
 9629.m05876|protein  ADP-ribosylation factor family             356  3e-98
 9636.m01507|protein  ADP-ribosylation factor 3 - Arabidops...   242  1e-63
 9638.m03942|protein  putative ADP-ribosylation factor           240  4e-63
 9630.m04581|protein  ADP-ribosylation factor family             238  1e-62
 9630.m00263|protein  ADP-ribosylation factor family             231  2e-60
 9634.m00141|protein  ADP-ribosylation factor family             209  8e-54
 9638.m03941|protein  putative ADP-ribosylation factor           186  5e-47
 9630.m02130|protein  probable adp-ribosylation factor at2g...   171  2e-42
 9638.m03940|protein  putative ADP-ribosylation factor           164  3e-40
 9639.m03408|protein  Similar to AY086337 ADP-ribosylation ...   138  1e-32
 9631.m02711|protein  putative GTP-binding protein               129  6e-30
 9635.m04291|protein  ADP-ribosylation factor family, putative   120  3e-27
 9631.m00948|protein  AY114718 ADP-ribosylation factor-like...   111  3e-24
 9630.m04896|protein  ADP-ribosylation factor-like protein       109  8e-24

  9635.m01193|protein  ADP-ribosylation factor family, putative
           Length = 304
           
 Score =  369 bits (938), Expect = e-102
 Identities = 196/254 (77%), Positives = 204/254 (80%), Gaps = 4/254 (1%)
 Frame = +1

Query: 46  QGGSPLPHPISSPAGR----HDYYLPVCSRCHRGIGHRFSAEITDPKIGSDIRIAWFSAA 213
           QG  PLP       GR     DY +P+        G+R   E+                 
Sbjct: 64  QGAGPLPLKGREAHGRCHRRRDYVMPLPLEGREAHGYRRRREVGREHA------------ 111

Query: 214 LDLRPVSVG*SEECKGEMGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIV 393
             L P      +E  G+MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIV
Sbjct: 112 -KLMPSE----KEEGGKMGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIV 166

Query: 394 TTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEA 573
           TTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEA
Sbjct: 167 TTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEA 226

Query: 574 RDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSG 753
           RDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+G
Sbjct: 227 RDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTG 286

Query: 754 EGLYEGLDWLSNNIASKA 807
           EGLYEGLDWLS+NIASKA
Sbjct: 287 EGLYEGLDWLSSNIASKA 304
  9635.m01196|protein  ADP-ribosylation factor family
           Length = 181
           
 Score =  366 bits (930), Expect = e-101
 Identities = 179/181 (98%), Positives = 181/181 (99%)
 Frame = +1

Query: 265 MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 444
           MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct: 1   MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 60

Query: 445 ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 624
           ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct: 61  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 120

Query: 625 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK 804
           LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIASK
Sbjct: 121 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASK 180

Query: 805 A 807
           A
Sbjct: 181 A 181
  9633.m03842|protein  ADP-ribosylation factor [imported] - rice
           Length = 181
           
 Score =  362 bits (919), Expect = e-100
 Identities = 177/181 (97%), Positives = 179/181 (98%)
 Frame = +1

Query: 265 MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 444
           MGL F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct: 1   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 60

Query: 445 ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 624
           ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct: 61  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV 120

Query: 625 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK 804
           LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K
Sbjct: 121 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 180

Query: 805 A 807
           A
Sbjct: 181 A 181
  9631.m05882|protein  ADP-ribosylation factor
           Length = 181
           
 Score =  361 bits (918), Expect = e-100
 Identities = 177/181 (97%), Positives = 179/181 (98%)
 Frame = +1

Query: 265 MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 444
           MGL F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct: 1   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 60

Query: 445 ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 624
           ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct: 61  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 120

Query: 625 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK 804
           LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIASK
Sbjct: 121 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASK 180

Query: 805 A 807
           A
Sbjct: 181 A 181
  9631.m05881|protein  ADP-ribosylation factor
           Length = 181
           
 Score =  361 bits (918), Expect = e-100
 Identities = 177/181 (97%), Positives = 179/181 (98%)
 Frame = +1

Query: 265 MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 444
           MGL F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct: 1   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN 60

Query: 445 ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 624
           ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct: 61  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV 120

Query: 625 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK 804
           LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIASK
Sbjct: 121 LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASK 180

Query: 805 A 807
           A
Sbjct: 181 A 181
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63781097 Number of Sequences: 59712 Number of extensions: 1657505 Number of successful extensions: 6972 Number of sequences better than 1.0e-10: 43 Number of HSP's better than 0.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6940 Number of HSP's gapped (non-prelim): 25 length of query: 343 length of database: 26,991,925 effective HSP length: 51 effective length of query: 292 effective length of database: 23,946,613 effective search space: 6992410996 effective search space used: 6992410996 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG189   Members:317            3pri:Y   1e-121      
B44956           chlorophyll a/b-binding protein II precursor - rice
prf||1707316B chlorophyll a/b binding protein 2
         (1087 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9631.m03807|protein  chlorophyll a/b binding protein            524  e-149
 9629.m05067|protein  Chlorophyll A-B binding protein, puta...   409  e-114
 9629.m03990|protein  Chlorophyll A-B binding protein, puta...   409  e-114
 9637.m01516|protein  chlorophyll a/b-binding protein I pre...   408  e-113
 9635.m03724|protein  chlorophyll a-b binding protein of lh...   363  e-100
 9639.m01284|protein  chlorophyll a/b-binding protein CP26 ...   212  7e-55
 9637.m00977|protein  Chlorophyll A-B binding protein, puta...   208  1e-53
 9635.m03882|protein  LHCI-680, photosystem I antenna prote...   145  1e-34
 9634.m02114|protein  chlorophyll a/b-binding protein precu...   131  2e-30
 9637.m02343|protein  AY086461 PSI type II chlorophyll a/b-...   129  1e-29
 9630.m05194|protein  light-harvesting complex protein [imp...   127  3e-29
 9630.m00958|protein  chlorophyll a/b-binding protein type ...   126  6e-29
 9639.m01283|protein  chlorophyll a/b-binding protein CP26 ...   115  1e-25
 9635.m03689|protein  probable chlorophyll a/b-binding prot...   114  3e-25
 9636.m03389|protein  chlorophyll a/b-binding protein presu...   113  4e-25
 9632.m03624|protein  chlorophyll a/b-binding apoprotein CP...    92  2e-18
 9630.m00957|protein  chlorophyll a/b-binding protein type ...    78  2e-14

  9631.m03807|protein  chlorophyll a/b binding protein
           Length = 263
           
 Score =  524 bits (1336), Expect = e-149
 Identities = 247/262 (94%), Positives = 255/262 (97%)
 Frame = +3

Query: 69  MAASALHQTTSFLGTAPRRDDLVRSVGDFGGRITMRRTVKSAPQSIWYGPDRPKYLGPFS 248
           MAASALHQTTSFLGTAPRRD+LVR VGD GGRITMRRTVKSAPQSIWYGPDRPKYLGPFS
Sbjct: 1   MAASALHQTTSFLGTAPRRDELVRRVGDSGGRITMRRTVKSAPQSIWYGPDRPKYLGPFS 60

Query: 249 EQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNG 428
           EQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNG
Sbjct: 61  EQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNG 120

Query: 429 IKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFIEGYRVGGGPLG 608
           +KFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA QVVLMGF+EGYRVGGGPLG
Sbjct: 121 VKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLG 180

Query: 609 EGLDIIYPGGAFDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVENL 788
           EGLD +YPGGAFDPLGLADDPDT AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL
Sbjct: 181 EGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENL 240

Query: 789 FDHIADPVNNNAWAFATNFAPG 854
           FDH+ADPV NNAWA+ATNF PG
Sbjct: 241 FDHVADPVANNAWAYATNFVPG 262
  9629.m05067|protein  Chlorophyll A-B binding protein, putative
           Length = 265
           
 Score =  409 bits (1041), Expect = e-114
 Identities = 201/262 (76%), Positives = 224/262 (84%), Gaps = 8/262 (3%)
 Frame = +3

Query: 69  MAAS--ALHQTTSFLGTAPRRDDLVRSVGDFG-GRITMRRTVK-----SAPQSIWYGPDR 224
           MAAS  AL    +  G A      V +   FG GR+TMR++       +A  S WYG DR
Sbjct: 1   MAASTMALSSPAALAGKA------VANAKVFGEGRVTMRKSAAKPKPAAASGSPWYGADR 54

Query: 225 PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVF 404
             YLGP S + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVF
Sbjct: 55  VLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF 114

Query: 405 PEILSKNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFIEGY 584
           PE+L++NG+KFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIW CQVVLMG +EGY
Sbjct: 115 PELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWGCQVVLMGAVEGY 174

Query: 585 RVGGGPLGEGLDIIYPGGAFDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVT 764
           RV GGPLGE +D +YPGG+FDPLGLADDP+  AELKVKE+KNGRLAMFSMFGFFVQAIVT
Sbjct: 175 RVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVT 234

Query: 765 GKGPVENLFDHIADPVNNNAWAFATNFAPG 854
           GKGP+ENL DH+ADPVNNNAWA+ATNF PG
Sbjct: 235 GKGPLENLADHLADPVNNNAWAYATNFVPG 264
  9629.m03990|protein  Chlorophyll A-B binding protein, putative
           Length = 261
           
 Score =  409 bits (1040), Expect = e-114
 Identities = 191/232 (82%), Positives = 212/232 (91%), Gaps = 4/232 (1%)
 Frame = +3

Query: 159 GRITMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADP 326
           GRITMR++      +A  S WYG DR  YLGP S + PSYLTGEFPGDYGWDTAGLSADP
Sbjct: 25  GRITMRKSAAKPKPAASGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADP 84

Query: 327 ETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGIKFGEAVWFKAGAQIFSEGGLDYLGN 506
           ETFAKNRELEVIHSRWAMLGALGCVFPE+L++NG+KFGEAVWFKAG+QIFSEGGLDYLGN
Sbjct: 85  ETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGN 144

Query: 507 PNLVHAQSILAIWACQVVLMGFIEGYRVGGGPLGEGLDIIYPGGAFDPLGLADDPDTAAE 686
           P+L+HAQSILAIWA QVVLMG +EGYR+ GGPLGE +D +YPGG+FDPLGLADDP+  AE
Sbjct: 145 PSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAE 204

Query: 687 LKVKELKNGRLAMFSMFGFFVQAIVTGKGPVENLFDHIADPVNNNAWAFATNFAPG 854
           LKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPVNNNAWA+ATNF PG
Sbjct: 205 LKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 260
  9637.m01516|protein  chlorophyll a/b-binding protein I precursor -
           rice
           Length = 265
           
 Score =  408 bits (1037), Expect = e-113
 Identities = 191/231 (82%), Positives = 211/231 (90%), Gaps = 5/231 (2%)
 Frame = +3

Query: 162 RITMRRTVK-----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADP 326
           RITMR+T       ++  S WYG DR  YLGP S + PSYLTGEFPGDYGWDTAGLSADP
Sbjct: 29  RITMRKTAAKPKPAASSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADP 88

Query: 327 ETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGIKFGEAVWFKAGAQIFSEGGLDYLGN 506
           ETFAKNRELEVIHSRWAMLGALGCVFPE+L++NG+KFGEAVWFKAG+QIFSEGGLDYLGN
Sbjct: 89  ETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGN 148

Query: 507 PNLVHAQSILAIWACQVVLMGFIEGYRVGGGPLGEGLDIIYPGGAFDPLGLADDPDTAAE 686
           P+L+HAQSILAIWA QVVLMG +EGYR+ GGPLGE +D +YPGGAFDPLGLADDP+  AE
Sbjct: 149 PSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGAFDPLGLADDPEAFAE 208

Query: 687 LKVKELKNGRLAMFSMFGFFVQAIVTGKGPVENLFDHIADPVNNNAWAFATNFAPG 854
           LKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPVNNNAWA+ATNF PG
Sbjct: 209 LKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 264
  9635.m03724|protein  chlorophyll a-b binding protein of lhcii type
           iii, chloroplastprecursor (cab)
           Length = 266
           
 Score =  363 bits (922), Expect = e-100
 Identities = 189/273 (69%), Positives = 211/273 (77%), Gaps = 4/273 (1%)
 Frame = +3

Query: 39  SSQAAPATSEMAASALHQTTSFLGTAPRRDDLVRSVGDFG-GRITMRRTVKSAPQSIWYG 215
           S+  AP +  +AA      T FLG     +  VR +     GRITM +        +WYG
Sbjct: 3   STIMAPTSRVLAAK-----TPFLGHPRPSNAPVRDIAAAATGRITMSK-------ELWYG 50

Query: 216 PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG 395
           PDR KYLGPFS QTPSYL GEFPGDYGWDTAGLSADPE FA+NR LEVIH RWAMLGALG
Sbjct: 51  PDRVKYLGPFSAQTPSYLRGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALG 110

Query: 396 CVFPEILSK-NGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGF 572
           C+ PE+L K   + F E VWFKAGAQIFS+GGLDYLGNPNLVHAQSILA+   QVVLMG 
Sbjct: 111 CITPEVLEKWVRVDFKEPVWFKAGAQIFSDGGLDYLGNPNLVHAQSILAVLGFQVVLMGL 170

Query: 573 IEGYRVGGGP-LGEGLDIIYPGGA-FDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFF 746
           +EGYR+ G P +G+G D +YPGG  FDPLGLADDP T AELKVKE+KNGRLAMFSMFGFF
Sbjct: 171 VEGYRINGLPGVGDGND-LYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFF 229

Query: 747 VQAIVTGKGPVENLFDHIADPVNNNAWAFATNFAPGS 857
           VQAIVTGKGP+ENL DH+ADPV NNAW +AT F PGS
Sbjct: 230 VQAIVTGKGPLENLLDHLADPVANNAWVYATKFTPGS 266
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80160082 Number of Sequences: 59712 Number of extensions: 2640935 Number of successful extensions: 24911 Number of sequences better than 1.0e-10: 34 Number of HSP's better than 0.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 24853 Number of HSP's gapped (non-prelim): 27 length of query: 362 length of database: 26,991,925 effective HSP length: 51 effective length of query: 310 effective length of database: 23,946,613 effective search space: 7423450030 effective search space used: 7423450030 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG278   Members:196            3pri:Y   1e-119      
AAK49116.1       alcohol dehydrogenase [Hordeum vulgare subsp.
vulgare]
         (1702 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9639.m00990|protein  alcohol dehydrogenase 1                    754  0.0
 9639.m00993|protein  alcohol dehydrogenase 2                    697  0.0
 9639.m00989|protein  alcohol dehydrogenase 1                    553  e-157
 9639.m00994|protein  alcohol dehydrogenase                      515  e-145
 9630.m05667|protein  alcohol dehydrogenase class iii (ec 1...   490  e-138
 9630.m05668|protein  alcohol dehydrogenase class iii (ec 1...   460  e-129
 9630.m04071|protein  AT5g24760/T4C12_30                         425  e-118
 9630.m04072|protein  AT5g24760/T4C12_30                         419  e-117
 9631.m00850|protein  alcohol dehydrogenase ADH                  325  2e-88
 9638.m00639|protein  oxidoreductase, zinc-binding dehydrog...   300  5e-81
 9631.m00847|protein  Similar to probable alcohol dehydroge...   289  9e-78
 9638.m00640|protein  oxidoreductase, zinc-binding dehydrog...   231  4e-60
 9635.m04301|protein  oxidoreductase, zinc-binding dehydrog...   178  2e-44
 9636.m00075|protein  alcohol dehydrogenase-like protein         152  2e-36
 9638.m00638|protein  expressed protein                          130  9e-30
 9632.m01422|protein  oxidoreductase, zinc-binding dehydrog...    91  5e-18
 9631.m00849|protein  expressed protein                           87  9e-17
 9637.m02016|protein  sinapyl alcohol dehydrogenase               82  2e-15
 9638.m01063|protein  putative cinnamyl-alcohol dehydrogenase     82  2e-15
 9638.m02516|protein  oxidoreductase, zinc-binding dehydrog...    80  1e-14

  9639.m00990|protein  alcohol dehydrogenase 1
            Length = 379
            
 Score =  754 bits (1925), Expect = 0.0
 Identities = 360/379 (94%), Positives = 371/379 (96%)
 Frame = +2

Query: 92   MATAGKVIKCKAAVAWEAGKPLTMEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQT 271
            MATAGKVIKCKAAVAWEA KPL +EEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQT
Sbjct: 1    MATAGKVIKCKAAVAWEAAKPLVIEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQT 60

Query: 272  PMFPRIFGHEAGGIVESVGEGVTDVAPGDHVLPVFTGECKECPHCKSAESNMCDLLRINT 451
            P+FPRIFGHEAGGIVESVGEGVTD+APGDHVLPVFTGECKEC HCKSAESNMCDLLRINT
Sbjct: 61   PVFPRIFGHEAGGIVESVGEGVTDLAPGDHVLPVFTGECKECAHCKSAESNMCDLLRINT 120

Query: 452  DRGVMIGDGKSRFSIGGKPIYHFVGTSTFSEYTVMHVGCVAKINPEAPLDKVCVLSCGIS 631
            DRGVMIGDGKSRFSI GKPIYHFVGTSTFSEYTVMHVGCVAKINP APLDKVCVLSCGIS
Sbjct: 121  DRGVMIGDGKSRFSINGKPIYHFVGTSTFSEYTVMHVGCVAKINPAAPLDKVCVLSCGIS 180

Query: 632  TGLGASINVAKPPKGSTVAIFGLGAVGLAAAEGARIAGASRIIGVDLNASRFEEARKFGC 811
            TGLGA+INVAKPPKGSTVAIFGLGAVGLAAAEGARIAGASRIIG+DLNA+RFEEARKFGC
Sbjct: 181  TGLGATINVAKPPKGSTVAIFGLGAVGLAAAEGARIAGASRIIGIDLNANRFEEARKFGC 240

Query: 812  TEFVNPKDHTKPVQQVLADMTNGGVDRSVECTGNVNAMIQAFECVHDGWGVAVLVGVPHK 991
            TEFVNPKDH KPVQQVLA+MTNGGVDRSVECTGN+NAMIQAFECVHDGWGVAVLVGVPHK
Sbjct: 241  TEFVNPKDHDKPVQQVLAEMTNGGVDRSVECTGNINAMIQAFECVHDGWGVAVLVGVPHK 300

Query: 992  DAEFKTHPMNFLNERTLKGTFFGNFKPRTDLPNVVEMYMKKELEVEKFITHSVPFSEINK 1171
            DAEFKTHPMNFLNERTLKGTFFGN+KPRTDLPNVVE+YMKKELEVEKFITHSVPFSEIN 
Sbjct: 301  DAEFKTHPMNFLNERTLKGTFFGNYKPRTDLPNVVELYMKKELEVEKFITHSVPFSEINT 360

Query: 1172 AFDLMAKGEGIRCIIRMDN 1228
            AFDLM KGEGIRCIIRM+N
Sbjct: 361  AFDLMHKGEGIRCIIRMEN 379
  9639.m00993|protein  alcohol dehydrogenase 2
            Length = 379
            
 Score =  697 bits (1780), Expect = 0.0
 Identities = 323/378 (85%), Positives = 357/378 (93%)
 Frame = +2

Query: 92   MATAGKVIKCKAAVAWEAGKPLTMEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQT 271
            MATAGKVIKCKAAVAWEAGKPL++EEVEVAPPQAMEVRVKIL+T+LCHTDVYFWEAKGQT
Sbjct: 1    MATAGKVIKCKAAVAWEAGKPLSIEEVEVAPPQAMEVRVKILYTALCHTDVYFWEAKGQT 60

Query: 272  PMFPRIFGHEAGGIVESVGEGVTDVAPGDHVLPVFTGECKECPHCKSAESNMCDLLRINT 451
            P+FPRI GHEAGGIVESVGEGVT++APGDHVLPVFTGECKEC HCKS ESNMCDLLRIN 
Sbjct: 61   PVFPRILGHEAGGIVESVGEGVTELAPGDHVLPVFTGECKECDHCKSEESNMCDLLRINV 120

Query: 452  DRGVMIGDGKSRFSIGGKPIYHFVGTSTFSEYTVMHVGCVAKINPEAPLDKVCVLSCGIS 631
            DRGVMIGDGKSRF+I GKPI+HFVGTSTFSEYTV+HVGC+AKINPEAPLDKVC+LSCG S
Sbjct: 121  DRGVMIGDGKSRFTIKGKPIFHFVGTSTFSEYTVIHVGCLAKINPEAPLDKVCILSCGFS 180

Query: 632  TGLGASINVAKPPKGSTVAIFGLGAVGLAAAEGARIAGASRIIGVDLNASRFEEARKFGC 811
            TG GA++NVAKP KG TVAIFGLGAVGLAA EGAR++GASRIIGVDLN ++FE+A+KFGC
Sbjct: 181  TGFGATVNVAKPKKGQTVAIFGLGAVGLAAMEGARLSGASRIIGVDLNPAKFEQAKKFGC 240

Query: 812  TEFVNPKDHTKPVQQVLADMTNGGVDRSVECTGNVNAMIQAFECVHDGWGVAVLVGVPHK 991
            T+FVNPKDH+KPV +VL +MTNGG+DR+VECTGN+NAMI  FECVHDGWGVAVLVGVP K
Sbjct: 241  TDFVNPKDHSKPVHEVLIEMTNGGLDRAVECTGNINAMISCFECVHDGWGVAVLVGVPTK 300

Query: 992  DAEFKTHPMNFLNERTLKGTFFGNFKPRTDLPNVVEMYMKKELEVEKFITHSVPFSEINK 1171
            D  FKTHPMNFLNE+TLKGTFFGN+KPRTDLPNVVE+YMKKELE+EKFITHSVPFSEIN 
Sbjct: 301  DDVFKTHPMNFLNEKTLKGTFFGNYKPRTDLPNVVELYMKKELELEKFITHSVPFSEINT 360

Query: 1172 AFDLMAKGEGIRCIIRMD 1225
            AFDLM KGE +RC++RMD
Sbjct: 361  AFDLMLKGESLRCVMRMD 378
  9639.m00989|protein  alcohol dehydrogenase 1
            Length = 290
            
 Score =  553 bits (1410), Expect(2) = e-157
 Identities = 264/280 (94%), Positives = 273/280 (97%)
 Frame = +2

Query: 389  KECPHCKSAESNMCDLLRINTDRGVMIGDGKSRFSIGGKPIYHFVGTSTFSEYTVMHVGC 568
            + C HCKSAESNMCDLLRINTDRGVMIGDGKSRFSI GKPIYHFVGTSTFSEYTVMHVGC
Sbjct: 11   ERCAHCKSAESNMCDLLRINTDRGVMIGDGKSRFSINGKPIYHFVGTSTFSEYTVMHVGC 70

Query: 569  VAKINPEAPLDKVCVLSCGISTGLGASINVAKPPKGSTVAIFGLGAVGLAAAEGARIAGA 748
            VAKINP APLDKVCVLSCGISTGLGA+INVAKPPKGSTVAIFGLGAVGLAAAEGARIAGA
Sbjct: 71   VAKINPAAPLDKVCVLSCGISTGLGATINVAKPPKGSTVAIFGLGAVGLAAAEGARIAGA 130

Query: 749  SRIIGVDLNASRFEEARKFGCTEFVNPKDHTKPVQQVLADMTNGGVDRSVECTGNVNAMI 928
            SRIIG+DLNA+RFEEARKFGCTEFVNPKDH KPVQQVLA+MTNGGVDRSVECTGN+NAMI
Sbjct: 131  SRIIGIDLNANRFEEARKFGCTEFVNPKDHDKPVQQVLAEMTNGGVDRSVECTGNINAMI 190

Query: 929  QAFECVHDGWGVAVLVGVPHKDAEFKTHPMNFLNERTLKGTFFGNFKPRTDLPNVVEMYM 1108
            QAFECVHDGWGVAVLVGVPHKDAEFKTHPMNFLNERTLKGTFFGN+KPRTDLPNVVE+YM
Sbjct: 191  QAFECVHDGWGVAVLVGVPHKDAEFKTHPMNFLNERTLKGTFFGNYKPRTDLPNVVELYM 250

Query: 1109 KKELEVEKFITHSVPFSEINKAFDLMAKGEGIRCIIRMDN 1228
            KKELEVEKFITHSVPFSEIN AFDLM KGEGIRCIIRM+N
Sbjct: 251  KKELEVEKFITHSVPFSEINTAFDLMHKGEGIRCIIRMEN 290
 Score = 23.5 bits (49), Expect(2) = e-157
 Identities = 10/12 (83%), Positives = 10/12 (83%)
 Frame = +3

Query: 297 MKLEA*WRVLER 332
           MKLE  WRVLER
Sbjct: 1   MKLEVLWRVLER 12
  9639.m00994|protein  alcohol dehydrogenase
           Length = 303
           
 Score =  515 bits (1311), Expect = e-145
 Identities = 241/287 (83%), Positives = 270/287 (93%), Gaps = 1/287 (0%)
 Frame = +2

Query: 92  MATAGKVIKCKAAVAWEAGKPLTMEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQT 271
           MATAGKVIKCKAAVAWEAGKPL++EEVEVAPPQAMEVR+KIL+T+LCHTDVYFWEAKGQT
Sbjct: 1   MATAGKVIKCKAAVAWEAGKPLSIEEVEVAPPQAMEVRLKILYTALCHTDVYFWEAKGQT 60

Query: 272 PMFPRIFGHEAGGIVESVGEGVTDVAPGDHVLPVFTGECKECPHCKSAESNMCDLLRINT 451
           P+FPRIFGHEAGGIVESVGEGVT+++PGDHVLPVFTGEC +C HC S ESN+CDLLRINT
Sbjct: 61  PVFPRIFGHEAGGIVESVGEGVTELSPGDHVLPVFTGECGDCRHCLSEESNLCDLLRINT 120

Query: 452 DRGVMIGDGKSRFSI-GGKPIYHFVGTSTFSEYTVMHVGCVAKINPEAPLDKVCVLSCGI 628
           DRG MIGDG++RF+  GG+P+YHF+GTSTFSEYTV+HVGCVAKI+P APLDKVCVLSCGI
Sbjct: 121 DRGAMIGDGQTRFTARGGQPVYHFLGTSTFSEYTVVHVGCVAKIHPAAPLDKVCVLSCGI 180

Query: 629 STGLGASINVAKPPKGSTVAIFGLGAVGLAAAEGARIAGASRIIGVDLNASRFEEARKFG 808
           STG GA++NVAKPPKG TVAIFGLGAVGLAA EGARI+GASRIIGVDLN ++FE A+KFG
Sbjct: 181 STGFGATVNVAKPPKGCTVAIFGLGAVGLAAMEGARISGASRIIGVDLNPAKFELAKKFG 240

Query: 809 CTEFVNPKDHTKPVQQVLADMTNGGVDRSVECTGNVNAMIQAFECVHD 952
           CT+FVNPKD+ KPVQQV+ +MTNGGVDRSVECTGN  AMI AFECVHD
Sbjct: 241 CTDFVNPKDYDKPVQQVIIEMTNGGVDRSVECTGNAAAMISAFECVHD 288
  9630.m05667|protein  alcohol dehydrogenase class iii (ec 1.1.1.1)
            (glutathione-dependentformaldehyde dehydrogenase) (ec
            1.2.1.1) (fdh) (faldh) (gsh-fdh)
            Length = 381
            
 Score =  490 bits (1249), Expect = e-138
 Identities = 229/377 (60%), Positives = 287/377 (75%)
 Frame = +2

Query: 95   ATAGKVIKCKAAVAWEAGKPLTMEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQTP 274
            +T G+VI CKAAVAWEA +P+T+E+V+VAPPQA EVRVKILFT+LCHTD Y W  K    
Sbjct: 4    STQGQVITCKAAVAWEANRPMTIEDVQVAPPQAGEVRVKILFTALCHTDHYTWSGKDPEG 63

Query: 275  MFPRIFGHEAGGIVESVGEGVTDVAPGDHVLPVFTGECKECPHCKSAESNMCDLLRINTD 454
            +FP I GHEA GIVESVGEGVT+V PGDHV+P +  EC+EC  CKS ++N+C  +R  T 
Sbjct: 64   LFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRAATG 123

Query: 455  RGVMIGDGKSRFSIGGKPIYHFVGTSTFSEYTVMHVGCVAKINPEAPLDKVCVLSCGIST 634
             GVM+ D KSRFSI GKPIYHF+GTSTFS+YTV+H   VAKINP+APLDKVC+L CG+ST
Sbjct: 124  VGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKINPQAPLDKVCLLGCGVST 183

Query: 635  GLGASINVAKPPKGSTVAIFGLGAVGLAAAEGARIAGASRIIGVDLNASRFEEARKFGCT 814
            GLGA  N AK   GS VAIFGLG VGLA AEGA+ AGASRIIG+D+++ +F+ A+ FG T
Sbjct: 184  GLGAVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKSAGASRIIGIDIDSKKFDVAKNFGVT 243

Query: 815  EFVNPKDHTKPVQQVLADMTNGGVDRSVECTGNVNAMIQAFECVHDGWGVAVLVGVPHKD 994
            EFVNPKDH KP+QQV+ D+T+GGVD S EC GNV+ M  A EC H GWG +V+VGV    
Sbjct: 244  EFVNPKDHDKPIQQVIVDLTDGGVDYSFECIGNVSVMRSALECCHKGWGTSVIVGVAASG 303

Query: 995  AEFKTHPMNFLNERTLKGTFFGNFKPRTDLPNVVEMYMKKELEVEKFITHSVPFSEINKA 1174
             E  T P   +  R  KGT FG FK R+ +P +VE Y+ KE++V++++THS+  ++INKA
Sbjct: 304  QEISTRPFQLVTGRVWKGTAFGGFKSRSQVPWLVEKYLNKEIKVDEYVTHSMNLTDINKA 363

Query: 1175 FDLMAKGEGIRCIIRMD 1225
            FDL+ +G  +RC++  D
Sbjct: 364  FDLLHEGGCLRCVLATD 380
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 110412477 Number of Sequences: 59712 Number of extensions: 3431199 Number of successful extensions: 55872 Number of sequences better than 1.0e-10: 49 Number of HSP's better than 0.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 14 Number of HSP's that attempted gapping in prelim test: 55821 Number of HSP's gapped (non-prelim): 35 length of query: 567 length of database: 26,991,925 effective HSP length: 52 effective length of query: 514 effective length of database: 23,886,901 effective search space: 12277867114 effective search space used: 12277867114 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG312   Members:49             3pri:Y   1e-106      
CAB64600.1       S-adenosylmethionine decarboxylase 2 [Oryza sativa
(japonica cultivar-group)]
         (1956 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9630.m03832|protein  Adenosylmethionine decarboxylase           642  0.0
 9632.m04015|protein  Adenosylmethionine decarboxylase           584  e-166
 9632.m04014|protein  Adenosylmethionine decarboxylase           584  e-166
 9637.m02218|protein  Adenosylmethionine decarboxylase           506  e-143
 9637.m02217|protein  Adenosylmethionine decarboxylase           506  e-143
 9633.m00430|protein  Similar to S-adenosylmethionine decar...   232  1e-60
 9637.m02110|protein  hypothetical protein                        71  7e-12

  9630.m03832|protein  Adenosylmethionine decarboxylase
            Length = 395
            
 Score =  642 bits (1638), Expect = 0.0
 Identities = 320/391 (81%), Positives = 344/391 (87%)
 Frame = +3

Query: 501  SEAMAVSAIGFEGYEKRLEITFSEASVFTDPNGRGLRALSRPQIDSVLDLAKCTIVSGLS 680
            +++  VSAIGFEGYEKRLEITFSEA VF DPNGRGLRALSR QIDSVLDLA+CTIVS LS
Sbjct: 7    ADSPPVSAIGFEGYEKRLEITFSEAPVFADPNGRGLRALSRAQIDSVLDLARCTIVSELS 66

Query: 681  NEKFDSYVLSESSLFVYPYTVVIKTCGTTKLLLAIPRILELAEELALPLAAVKYSRGAFI 860
            NE FDSYVLSESSLFVYPY +VIKTCGTTKLLLAIPRILELAEEL+LPL AVKYSRG FI
Sbjct: 67   NEVFDSYVLSESSLFVYPYKIVIKTCGTTKLLLAIPRILELAEELSLPLEAVKYSRGTFI 126

Query: 861  FPEAQPSPHKNFSDEVAFLNGYFGGLKSGGNAYVIGDPAKPGQKWHVYYATQQPEQPVVN 1040
            FPEAQPSPHKNFS+EVA LN YFGGLKSGGNAYVIGDPAKPGQKWHVYYATQ PEQPVV 
Sbjct: 127  FPEAQPSPHKNFSEEVAVLNRYFGGLKSGGNAYVIGDPAKPGQKWHVYYATQHPEQPVVT 186

Query: 1041 LEMCMTGLDKKKASVFFKTSADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNA 1220
            LEMCMTGLDKKKASVFFKTSADGHT+ AKEMTKLSGISDIIPEME+CDFDFEPCGYSMNA
Sbjct: 187  LEMCMTGLDKKKASVFFKTSADGHTTYAKEMTKLSGISDIIPEMEVCDFDFEPCGYSMNA 246

Query: 1221 IHGSAFSTIHVTPEDGFSYGSYEVMGLDPASMAYGDLVKRVLRSFGPSEFSVAVTIFGCP 1400
            IHG AFSTIHVTPEDGFSY SYEVMG +PAS+AYGDLVKRVLR FGP EFSVAVTIFG  
Sbjct: 247  IHGPAFSTIHVTPEDGFSYASYEVMGFNPASLAYGDLVKRVLRCFGPLEFSVAVTIFGGR 306

Query: 1401 SLAGTWGERLNVGVYDSTNMVVQELPGGGSLIYQSFTAAGEDSSGSPRSVLNCYVDGNLQ 1580
            + AGTW + L+VG Y  +NMV QELP GG LIYQSFTA  E ++GSPRSVL+C+ D N +
Sbjct: 307  NHAGTWAKGLDVGAYSCSNMVEQELPSGGLLIYQSFTATAEIATGSPRSVLHCFADENTE 366

Query: 1581 SASKVDAFLCWEDDAAQEKDERRGDGKKMRS 1673
             A K++A L WEDDA +E D    +GKKMRS
Sbjct: 367  KAGKMEA-LYWEDDAVEEIDGT--EGKKMRS 394
  9632.m04015|protein  Adenosylmethionine decarboxylase
            Length = 398
            
 Score =  584 bits (1490), Expect = e-166
 Identities = 294/375 (78%), Positives = 323/375 (85%), Gaps = 8/375 (2%)
 Frame = +3

Query: 516  VSAIGFEGYEKRLEITFSEASVFTDPNGRGLRALSRPQIDSVLDLAKCTIVSGLSNEKFD 695
            VSAIGFEGYEKRLEITFSEA VF DP+GRGLRALSR QIDSVLDLA+CTIVS LSN+ FD
Sbjct: 12   VSAIGFEGYEKRLEITFSEAPVFADPDGRGLRALSRAQIDSVLDLARCTIVSELSNKDFD 71

Query: 696  SYVLSESSLFVYPYTVVIKTCGTTKLLLAIPRILELAEELALPLAAVKYSRGAFIFPEAQ 875
            SYVLSESSLF+Y   +VIKTCGTTKLLL IPRILELAE L++PLAAVKYSRG FIFP AQ
Sbjct: 72   SYVLSESSLFIYSDKIVIKTCGTTKLLLTIPRILELAEGLSMPLAAVKYSRGMFIFPSAQ 131

Query: 876  PSPHKNFSDEVAFLNGYFGGLKSGGNAYVIGDPAKPGQKWHVYYATQQPEQPVVNLEMCM 1055
            P+PH++FS+EVA LN YFG LKSGGNAYVIGDPAKPGQKWH+YYATQ PEQP+V LEMCM
Sbjct: 132  PAPHRSFSEEVAVLNRYFGHLKSGGNAYVIGDPAKPGQKWHIYYATQHPEQPMVTLEMCM 191

Query: 1056 TGLDKKKASVFFKTSADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHGSA 1235
            TGLDK+KASVFFKTSADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHGSA
Sbjct: 192  TGLDKEKASVFFKTSADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHGSA 251

Query: 1236 FSTIHVTPEDGFSYGSYEVMGLDPASMAYGDLVKRVLRSFGPSEFSVAVTIFGCPSLAGT 1415
            FSTIHVTPEDGFSY SYEV+G D +++AYGDLVKRVLR FGPSEFSVAVTIFG    AGT
Sbjct: 252  FSTIHVTPEDGFSYASYEVVGFDASTLAYGDLVKRVLRCFGPSEFSVAVTIFGGHGHAGT 311

Query: 1416 WGERLNVGVYDSTNMVVQELPGGGSLIYQSFTAAGED---SSGSPRSVLNCYVDGNLQSA 1586
            W + LN   Y   NMV QELP GG LIYQSF A  ED   + GSP+SVL+C+   N+ + 
Sbjct: 312  WAKELNADAYKCNNMVEQELPCGGLLIYQSFDAT-EDVPVAVGSPKSVLHCFEAENMVNP 370

Query: 1587 S-----KVDAFLCWEDDAAQEKD 1640
            +     K+   L W +DA +E D
Sbjct: 371  APVKEGKLGNLLPWGEDALEEND 393
  9632.m04014|protein  Adenosylmethionine decarboxylase
            Length = 398
            
 Score =  584 bits (1490), Expect = e-166
 Identities = 294/375 (78%), Positives = 323/375 (85%), Gaps = 8/375 (2%)
 Frame = +3

Query: 516  VSAIGFEGYEKRLEITFSEASVFTDPNGRGLRALSRPQIDSVLDLAKCTIVSGLSNEKFD 695
            VSAIGFEGYEKRLEITFSEA VF DP+GRGLRALSR QIDSVLDLA+CTIVS LSN+ FD
Sbjct: 12   VSAIGFEGYEKRLEITFSEAPVFADPDGRGLRALSRAQIDSVLDLARCTIVSELSNKDFD 71

Query: 696  SYVLSESSLFVYPYTVVIKTCGTTKLLLAIPRILELAEELALPLAAVKYSRGAFIFPEAQ 875
            SYVLSESSLF+Y   +VIKTCGTTKLLL IPRILELAE L++PLAAVKYSRG FIFP AQ
Sbjct: 72   SYVLSESSLFIYSDKIVIKTCGTTKLLLTIPRILELAEGLSMPLAAVKYSRGMFIFPSAQ 131

Query: 876  PSPHKNFSDEVAFLNGYFGGLKSGGNAYVIGDPAKPGQKWHVYYATQQPEQPVVNLEMCM 1055
            P+PH++FS+EVA LN YFG LKSGGNAYVIGDPAKPGQKWH+YYATQ PEQP+V LEMCM
Sbjct: 132  PAPHRSFSEEVAVLNRYFGHLKSGGNAYVIGDPAKPGQKWHIYYATQHPEQPMVTLEMCM 191

Query: 1056 TGLDKKKASVFFKTSADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHGSA 1235
            TGLDK+KASVFFKTSADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHGSA
Sbjct: 192  TGLDKEKASVFFKTSADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHGSA 251

Query: 1236 FSTIHVTPEDGFSYGSYEVMGLDPASMAYGDLVKRVLRSFGPSEFSVAVTIFGCPSLAGT 1415
            FSTIHVTPEDGFSY SYEV+G D +++AYGDLVKRVLR FGPSEFSVAVTIFG    AGT
Sbjct: 252  FSTIHVTPEDGFSYASYEVVGFDASTLAYGDLVKRVLRCFGPSEFSVAVTIFGGHGHAGT 311

Query: 1416 WGERLNVGVYDSTNMVVQELPGGGSLIYQSFTAAGED---SSGSPRSVLNCYVDGNLQSA 1586
            W + LN   Y   NMV QELP GG LIYQSF A  ED   + GSP+SVL+C+   N+ + 
Sbjct: 312  WAKELNADAYKCNNMVEQELPCGGLLIYQSFDAT-EDVPVAVGSPKSVLHCFEAENMVNP 370

Query: 1587 S-----KVDAFLCWEDDAAQEKD 1640
            +     K+   L W +DA +E D
Sbjct: 371  APVKEGKLGNLLPWGEDALEEND 393
  9637.m02218|protein  Adenosylmethionine decarboxylase
            Length = 392
            
 Score =  506 bits (1290), Expect = e-143
 Identities = 256/374 (68%), Positives = 297/374 (78%), Gaps = 2/374 (0%)
 Frame = +3

Query: 519  SAIGFEGYEKRLEITFSEASVFTDPNGRGLRALSRPQIDSVLDLAKCTIVSGLSNEKFDS 698
            S IGFEGYEKRLEIT S+A VF DP GRGLRALSR QIDS LDLAKCTIVS LSN+ FDS
Sbjct: 15   SPIGFEGYEKRLEITLSDAPVFVDPCGRGLRALSREQIDSFLDLAKCTIVSHLSNKHFDS 74

Query: 699  YVLSESSLFVYPYTVVIKTCGTTKLLLAIPRILELAEELALPLAAVKYSRGAFIFPEAQP 878
            YVLSESSLFVYP+ VV+KTCGTTKLLL+IPRILELA EL+LP+ +VKYSRG FIFP AQP
Sbjct: 75   YVLSESSLFVYPHKVVLKTCGTTKLLLSIPRILELAAELSLPVLSVKYSRGMFIFPGAQP 134

Query: 879  SPHKNFSDEVAFLNGYFGGLKSGGNAYVIGDPAKPGQKWHVYYATQQPEQPVVNLEMCMT 1058
            SPH++F +EV+ LN +FGGLKSGGNAYVIGD  KP +KWHVYYAT++PEQP+V LEMCMT
Sbjct: 135  SPHRSFLEEVSVLNSFFGGLKSGGNAYVIGDAFKPKKKWHVYYATEEPEQPMVTLEMCMT 194

Query: 1059 GLDKKKASVFFKTSADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHGSAF 1238
            GLD KKA VFFK S DG  S AKEMT  SGIS+IIPEMEICDF+F+PCGYSMN I+G A 
Sbjct: 195  GLDAKKAEVFFKDSTDGSCSSAKEMTMFSGISEIIPEMEICDFEFDPCGYSMNGIYGPAV 254

Query: 1239 STIHVTPEDGFSYGSYEVMGLDPASMAYGDLVKRVLRSFGPSEFSVAVTIFGCPSLAGTW 1418
            STIHVTPE+GFSY SYE M  +P+S+ Y DL+K+VL  F PS+FSVAVTIFG    A +W
Sbjct: 255  STIHVTPEEGFSYASYEAMNFNPSSLVYDDLIKKVLACFCPSDFSVAVTIFGGHGFAKSW 314

Query: 1419 GERLNVGVYDSTNMVVQELPGGGSLIYQSFTAAGEDSSGSPRSVLNCY-VDGNLQSASKV 1595
             +   V  Y   ++V QELPGGG L+YQSFTA     + SPRS L+ +  DG    A   
Sbjct: 315  AKGAEVDSYMCDDLVEQELPGGGVLMYQSFTAV-TPGAVSPRSTLDGWNSDGAEMVAKSK 373

Query: 1596 DAFLCWE-DDAAQEKD 1640
            +  +CWE + AA++KD
Sbjct: 374  EMSVCWEGEKAAKKKD 389
  9637.m02217|protein  Adenosylmethionine decarboxylase
            Length = 392
            
 Score =  506 bits (1290), Expect = e-143
 Identities = 256/374 (68%), Positives = 297/374 (78%), Gaps = 2/374 (0%)
 Frame = +3

Query: 519  SAIGFEGYEKRLEITFSEASVFTDPNGRGLRALSRPQIDSVLDLAKCTIVSGLSNEKFDS 698
            S IGFEGYEKRLEIT S+A VF DP GRGLRALSR QIDS LDLAKCTIVS LSN+ FDS
Sbjct: 15   SPIGFEGYEKRLEITLSDAPVFVDPCGRGLRALSREQIDSFLDLAKCTIVSHLSNKHFDS 74

Query: 699  YVLSESSLFVYPYTVVIKTCGTTKLLLAIPRILELAEELALPLAAVKYSRGAFIFPEAQP 878
            YVLSESSLFVYP+ VV+KTCGTTKLLL+IPRILELA EL+LP+ +VKYSRG FIFP AQP
Sbjct: 75   YVLSESSLFVYPHKVVLKTCGTTKLLLSIPRILELAAELSLPVLSVKYSRGMFIFPGAQP 134

Query: 879  SPHKNFSDEVAFLNGYFGGLKSGGNAYVIGDPAKPGQKWHVYYATQQPEQPVVNLEMCMT 1058
            SPH++F +EV+ LN +FGGLKSGGNAYVIGD  KP +KWHVYYAT++PEQP+V LEMCMT
Sbjct: 135  SPHRSFLEEVSVLNSFFGGLKSGGNAYVIGDAFKPKKKWHVYYATEEPEQPMVTLEMCMT 194

Query: 1059 GLDKKKASVFFKTSADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHGSAF 1238
            GLD KKA VFFK S DG  S AKEMT  SGIS+IIPEMEICDF+F+PCGYSMN I+G A 
Sbjct: 195  GLDAKKAEVFFKDSTDGSCSSAKEMTMFSGISEIIPEMEICDFEFDPCGYSMNGIYGPAV 254

Query: 1239 STIHVTPEDGFSYGSYEVMGLDPASMAYGDLVKRVLRSFGPSEFSVAVTIFGCPSLAGTW 1418
            STIHVTPE+GFSY SYE M  +P+S+ Y DL+K+VL  F PS+FSVAVTIFG    A +W
Sbjct: 255  STIHVTPEEGFSYASYEAMNFNPSSLVYDDLIKKVLACFCPSDFSVAVTIFGGHGFAKSW 314

Query: 1419 GERLNVGVYDSTNMVVQELPGGGSLIYQSFTAAGEDSSGSPRSVLNCY-VDGNLQSASKV 1595
             +   V  Y   ++V QELPGGG L+YQSFTA     + SPRS L+ +  DG    A   
Sbjct: 315  AKGAEVDSYMCDDLVEQELPGGGVLMYQSFTAV-TPGAVSPRSTLDGWNSDGAEMVAKSK 373

Query: 1596 DAFLCWE-DDAAQEKD 1640
            +  +CWE + AA++KD
Sbjct: 374  EMSVCWEGEKAAKKKD 389
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 124908183 Number of Sequences: 59712 Number of extensions: 3431812 Number of successful extensions: 13050 Number of sequences better than 1.0e-10: 14 Number of HSP's better than 0.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 13037 Number of HSP's gapped (non-prelim): 7 length of query: 652 length of database: 26,991,925 effective HSP length: 53 effective length of query: 598 effective length of database: 23,827,189 effective search space: 14248659022 effective search space used: 14248659022 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 161 (67.1 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG314   Members:21             3pri:Y   1e-101      
NP_199430.1      ornithine--oxo-acid aminotransferase (ornithine
aminotransferase/ornithine ketoacid aminotransferase),
         (1393 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9631.m04261|protein  Similar to ornithine aminotransferase      609  e-174
 9633.m00308|protein  glutamate--cysteine ligase, putative       167  5e-41
 9635.m02693|protein  acetylornithine aminotransferase, mit...   150  7e-36
 9636.m01011|protein  gamma-aminobutyrate transaminase subu...   130  5e-30
 9630.m00122|protein  aminotransferase, putative                 120  4e-27
 9632.m05081|protein  aminotransferase-like protein              118  3e-26
 9631.m02196|protein  aminotransferase, putative                 108  2e-23
 9633.m03704|protein  probable beta-alanine-pyruvate aminot...   108  2e-23
 9631.m00692|protein  alanine:glyoxylate aminotransferase 2...   108  2e-23
 9631.m00691|protein  alanine:glyoxylate aminotransferase 2...   108  2e-23
 9636.m04266|protein  glutamate-1-semialdehyde-2,1-aminomutase    98  4e-20

  9631.m04261|protein  Similar to ornithine aminotransferase
            Length = 444
            
 Score =  609 bits (1553), Expect = e-174
 Identities = 297/322 (92%), Positives = 315/322 (97%), Gaps = 17/322 (5%)
 Frame = +2

Query: 2    ERLTLSSRAFYNDKFPVFAEYLTTMFGYDMMLPMNTGAEGVETAIKLARKWGYEKKNIPK 181
            ERLTLSSRAFYNDKFP+FAEYLT+MFGY+MMLPMNTGAEGVETAIKL RKWGYEKK IPK
Sbjct: 105  ERLTLSSRAFYNDKFPIFAEYLTSMFGYEMMLPMNTGAEGVETAIKLVRKWGYEKKKIPK 164

Query: 182  NEALIVSCCGCFHGRTLGVISMSCDNDATRGFGPLVPGHLKVDFGDINGLEKIFKEHGDR 361
            NEALIVSCCGCFHGRTLGVISMSCDNDATRGFGPLVPGHLKVDFGD +GLEKIFK+HG+R
Sbjct: 165  NEALIVSCCGCFHGRTLGVISMSCDNDATRGFGPLVPGHLKVDFGDTDGLEKIFKDHGER 224

Query: 362  ICGFLFEPIQGEAGVIIPPDGYLKAVRDLCSRHNILMIDDEIQTGIARTGKMLACDWEDV 541
            ICGFLFEPIQGEAGVIIPPDGYLKAVRDLCSRHNILMI DEIQTGIARTGKMLACDWE++
Sbjct: 225  ICGFLFEPIQGEAGVIIPPDGYLKAVRDLCSRHNILMIADEIQTGIARTGKMLACDWENI 284

Query: 542  RPDMVILGKALGAGVVPVSAVLADKDIMLCIKPGEHGSTFGGNPLASAVAIASLKVVKDE 721
            RPD+VILGKALGAGVVPVSAVLADKDIMLCIKPGEHGSTFGGNPLASAVA+ASLKVV DE
Sbjct: 285  RPDVVILGKALGAGVVPVSAVLADKDIMLCIKPGEHGSTFGGNPLASAVAVASLKVVTDE 344

Query: 722  GLVE-----------------RAAELGQEFRDQLQEVQQKFPHIIREIRGRGLLNAVDLS 850
            GLVE                 RAA+LGQEFRDQLQ+VQQ+FP IIRE+RGRGLLNAVDLS
Sbjct: 345  GLVESCMIVYEYLSSKHLLNYRAAKLGQEFRDQLQKVQQRFPQIIREVRGRGLLNAVDLS 404

Query: 851  SKALYPASAYDICIKLKERGILAKPTHDTIIRLAPPISI 967
            ++AL PASAYDICIKLKERG+LAKPTHDTIIRLAPP+SI
Sbjct: 405  NEALSPASAYDICIKLKERGVLAKPTHDTIIRLAPPLSI 443
  9633.m00308|protein  glutamate--cysteine ligase, putative
            Length = 800
            
 Score =  167 bits (418), Expect = 5e-41
 Identities = 100/310 (32%), Positives = 165/310 (52%), Gaps = 3/310 (0%)
 Frame = +2

Query: 86   DMMLPMNTGAEGVETAIKLARKWGYEKKNIPKNEAL--IVSCCGCFHGRTLGVISMSCDN 259
            D +   NTG E  E AIK ARK  +++   P  +A    +S   CFHGRT+G ++++   
Sbjct: 492  DRVFFANTGTEANEAAIKFARK--FQRVARPDGDAPTEFMSFTNCFHGRTMGSLALTSKV 549

Query: 260  DATRGFGPLVPGHLKVDFGDINGLEKIFKEHGDRICGFLFEPIQGEAGVIIPPDGYLKAV 439
                 F P++PG    ++G++   +K+ +    +I     EP+QGE G+      +L+ +
Sbjct: 550  QYREPFAPVMPGATFAEYGNLEEAKKVIQS--GKIAAVFVEPVQGEGGIHSATKEFLQGL 607

Query: 440  RDLCSRHNILMIDDEIQTGIARTGKMLACDWEDVRPDMVILGKALGAGVVPVSAVLADKD 619
            RD C     L++ DE+Q G+ RTG + A +   V PD++ L K L AG +P+  VL  + 
Sbjct: 608  RDACDEAGALLVFDEVQCGLGRTGYLWAYEAYGVLPDIMTLAKPL-AGGLPIGVVLVTEK 666

Query: 620  IMLCIKPGEHGSTFGGNPLASAVAIASLKVVKDEGLVERAAELGQEFRDQLQEVQQKFPH 799
            +   I  G+HG+TFGG PL    A+ +L  ++  G +   A+ G+ F+  L        H
Sbjct: 667  VASAINFGDHGTTFGGGPLVCQAALTTLDKIQKPGFLAEVAKKGENFKQLLSTKLSGNAH 726

Query: 800  IIREIRGRGLLNAVDLSSKALYPASAYDICIKLKERGILAKPT-HDTIIRLAPPISISPE 976
             ++EIRG GL+  ++L   A       D C+   +RG++        ++RL PP+ IS +
Sbjct: 727  -VKEIRGIGLIVGIELDVPA---GPLVDACL---DRGVIVLTAGKGNVVRLVPPLIISEK 779

Query: 977  ELAEASKALSDVL 1015
            EL +A++ + D L
Sbjct: 780  ELEQAAEVIRDCL 792
  9635.m02693|protein  acetylornithine aminotransferase,
           mitochondrial precursor (ec 2.6.1.11) (acoat)
           (acetylornithine transaminase) (aota). [alder
           Length = 448
           
 Score =  150 bits (374), Expect = 7e-36
 Identities = 90/277 (32%), Positives = 146/277 (52%), Gaps = 2/277 (0%)
 Frame = +2

Query: 86  DMMLPMNTGAEGVETAIKLARKWGYEKKNIPKNEAL--IVSCCGCFHGRTLGVISMSCDN 259
           D +   NTG E  E AIK ARK  Y++   P  +A    +S   CFHGRT+G ++++   
Sbjct: 168 DRVFFANTGTEANEAAIKFARK--YQRVARPDGDAPTEFMSFTNCFHGRTMGSLALTSKV 225

Query: 260 DATRGFGPLVPGHLKVDFGDINGLEKIFKEHGDRICGFLFEPIQGEAGVIIPPDGYLKAV 439
                F P++PG    ++G++   +K+ +    +I     EP+QGE G+      +L+ +
Sbjct: 226 QYREPFAPVMPGATFAEYGNLEEAKKVIQS--GKIAAVFVEPMQGEGGIHSATKEFLQGL 283

Query: 440 RDLCSRHNILMIDDEIQTGIARTGKMLACDWEDVRPDMVILGKALGAGVVPVSAVLADKD 619
           RD C     L++ DE+Q G+ RTG + A +   V PD++ L K L AG +P+  VL  + 
Sbjct: 284 RDACDEAGALLVFDEVQCGLGRTGYLWAYEAYGVVPDIMTLAKPL-AGGLPIGVVLVTEK 342

Query: 620 IMLCIKPGEHGSTFGGNPLASAVAIASLKVVKDEGLVERAAELGQEFRDQLQEVQQKFPH 799
           +   I  G+HG+TFGG PL    A+ +L  ++  G +   A+ G+ F+  L        H
Sbjct: 343 VASAINYGDHGTTFGGGPLVCQAALTTLDKIQKPGFLAEVAKKGENFKQLLSTKLSGNAH 402

Query: 800 IIREIRGRGLLNAVDLSSKALYPASAYDICIKLKERGIL 916
            ++EIRG GL+  ++L   A       D C+   +RG++
Sbjct: 403 -VKEIRGIGLIVGIELDVPA---GPLVDACL---DRGVI 434
  9636.m01011|protein  gamma-aminobutyrate transaminase subunit
            precursor isozyme 3
            Length = 510
            
 Score =  130 bits (324), Expect = 5e-30
 Identities = 95/305 (31%), Positives = 162/305 (52%), Gaps = 33/305 (10%)
 Frame = +2

Query: 104  NTGAEGVETAIKLARKWGYEKKNIPKNEALIVSCCGCFHGRTLGVISMS----------- 250
            N+G+E  ++ +KL   W Y       N+   ++    +HG TL   S+S           
Sbjct: 164  NSGSEANDSQVKLV--WYYNNALGRPNKKKFIARSKSYHGSTLVSASLSGLPALHQKFDL 221

Query: 251  -----CDNDATRGFGPLVPGHLKVDFGD--INGLEK-IFKEHGDRICGFLFEPIQGEAGV 406
                    D    +   +P   + +F       LE  I KE  + I  F+ EP+ G  GV
Sbjct: 222  PAPFVLHTDCPHYWRFHLPDETEEEFATRLATNLENLILKEGPETIAAFIAEPVMGAGGV 281

Query: 407  IIPPDGYLKAVRDLCSRHNILMIDDEIQTGIARTGKMLACDWEDVRPDMVILGKALGAGV 586
            I PP  Y + ++ +  +++IL+I DE+ T   R G M  CD  D++PD+V + KAL +  
Sbjct: 282  IPPPKTYFEKIQAVLKKYDILLIADEVITAFGRLGTMFGCDMYDIKPDLVSIAKALSSAY 341

Query: 587  VPVSAVLADKDIMLCI-----KPGE--HGSTFGGNPLASAVAIASLKVVKDEGLVERAAE 745
            +P+ A+L   +I   I     K G   HG T+ G+P++ AVAI +LK+ K+  ++E   +
Sbjct: 342  MPIGAILVSPEITDVIYSQSNKLGSFAHGFTYSGHPVSCAVAIEALKIYKERNIIEHVQK 401

Query: 746  LGQEFRDQLQEVQQKFPHIIREIRGRGLLNAVDL----SSKALYPAS---AYDICIKLKE 904
            +   F++ ++        I+ EIRG GL+   +     S    +PA          + ++
Sbjct: 402  IAPRFQEGIKAFSGS--PIVGEIRGLGLILGTEFVDNKSPNDPFPAEWGVGSLFGAECEK 459

Query: 905  RGILAKPTHDTIIRLAPPISISPEELAEASKALSDVLE 1018
            RG+L +   D I+ L+PP+ ++P+E+ E      D L+
Sbjct: 460  RGMLIRVAGDNIM-LSPPLIMTPDEVEEIICKYGDALK 496
  9630.m00122|protein  aminotransferase, putative
            Length = 765
            
 Score =  120 bits (299), Expect = 4e-27
 Identities = 91/305 (29%), Positives = 159/305 (51%), Gaps = 21/305 (6%)
 Frame = +2

Query: 104  NTGAEGVETAIKLARKWGYEKKNIPKNEALIVSCCGCFHGRTLGVISMS----CDNDATR 271
            N+G+E  ++ +K+   W Y        +  I+S    +HG T    S+S    C +    
Sbjct: 436  NSGSEANDSQVKIV--WYYNNALGRPKKKNIISRTQSYHGTTFISASLSGILICQDVLFC 493

Query: 272  GFGPLVPG---HLKVDFGDINGLEKIFKEHGDRICGFLFEPIQGEAGVIIPPDGYLKAVR 442
                L  G    L   F +IN         G +I  F+ EP+ G  GVI+PP  Y + ++
Sbjct: 494  TQTALTTGASISLSAFFDEINDF------CGRQIAAFIAEPVIGAGGVILPPKTYFEKIQ 547

Query: 443  DLCSRHNILMIDDEIQTGIARTGKMLACDWEDVRPDMVILGKALGAGVVPVSAVLADKDI 622
             +  +++IL I DE+ TG  R G M   D  +++PD+V L KAL +   P+ A+L   +I
Sbjct: 548  AVVKKYDILFIVDEVITGFGRLGTMFGSDLYNIKPDLVSLAKALSSAYAPIGAILVSPEI 607

Query: 623  MLCI-----KPG--EHGSTFGGNPLASAVAIASLKVVKDEGLVERAAELGQEFRDQLQEV 781
               I     K G   HG T+ G+P++ AVA+ +LK+ ++  +      + Q F++ ++  
Sbjct: 608  SDVIHSHSNKLGTFAHGFTYSGHPVSCAVALEALKIYRERDIPGHVTHVAQRFQEGIKAF 667

Query: 782  QQKFPHIIREIRGRGLLNAVDLS-SKALYPASAYDICI------KLKERGILAKPTHDTI 940
                P I+ E RG GLL A + + +K+ Y    ++  +      + K+RG++ K     +
Sbjct: 668  AAGSP-IVGETRGVGLLIATEFTDNKSPYELFPFEWGVGEIFGQECKKRGMMVK-VLGNL 725

Query: 941  IRLAPPISISPEELAEASKALSDVLE 1018
            I ++PP+ I+ EE+ +      + L+
Sbjct: 726  IAMSPPLIITREEIDKLVSIYGEALK 751
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81692108 Number of Sequences: 59712 Number of extensions: 2072090 Number of successful extensions: 5959 Number of sequences better than 1.0e-10: 22 Number of HSP's better than 0.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 5928 Number of HSP's gapped (non-prelim): 12 length of query: 464 length of database: 26,991,925 effective HSP length: 52 effective length of query: 411 effective length of database: 23,886,901 effective search space: 9817516311 effective search space used: 9817516311 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG320   Members:4              3pri:Y   9e-44       
T02995           unspecific monooxygenase (EC 1.14.14.1) - common
tobacco dbj|BAA10929.1| cytochrome P450 like_TBP [Nicotiana t
         (1383 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

 ***** No hits found ******

  Database: all.pep
    Posted date:  Nov 22, 2004 11:49 AM
  Number of letters in database: 26,991,925
  Number of sequences in database:  59,712
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 84194810
Number of Sequences: 59712
Number of extensions: 2364121
Number of successful extensions: 10963
Number of sequences better than 1.0e-10: 0
Number of HSP's better than  0.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 10963
Number of HSP's gapped (non-prelim): 0
length of query: 461
length of database: 26,991,925
effective HSP length: 52
effective length of query: 408
effective length of database: 23,886,901
effective search space: 9745855608
effective search space used: 9745855608
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG322   Members:31             3pri:Y   2e-76       
BAA92982.1       unnamed protein product [Oryza sativa (japonica
cultivar-group)] dbj|BAA94790.1| unnamed protein product [Oryz
         (1180 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9629.m01274|protein  AUX/IAA family                             392  e-109
 9629.m01273|protein  AUX/IAA family                             392  e-109
 9633.m01237|protein  AUX/IAA family                             377  e-104
 9629.m04665|protein  AUX/IAA family                             222  9e-58
 9633.m04541|protein  AUX/IAA family                             213  6e-55
 9631.m05209|protein  putative auxin-responsive protein (wi...   203  4e-52
 9640.m04001|protein  auxin-responsive protein IAA1              199  8e-51
 9635.m00801|protein  AUX/IAA family                             172  9e-43
 9640.m04002|protein  AUX/IAA family                             171  2e-42
 9634.m02250|protein  IAA14                                      168  2e-41
 9631.m04182|protein  Similar to auxin-induced protein 22d ...   165  1e-40
 9631.m05210|protein  putative auxin-responsive protein (wi...   159  7e-39
 9629.m00770|protein  AUX/IAA family                             142  1e-33
 9631.m04181|protein  auxin-induced protein aux28. [soybean      138  1e-32
 9630.m05694|protein  Similar to At2g33310                       138  2e-32
 9631.m05736|protein  putative auxin-induced protein             137  4e-32
 9630.m05695|protein  Similar to At2g33310                       134  4e-31
 9634.m03786|protein  IAA14                                      133  5e-31
 9629.m00893|protein  AUX/IAA family                             122  1e-27
 9629.m00892|protein  AUX/IAA family                             121  2e-27

  9629.m01274|protein  AUX/IAA family
           Length = 263
           
 Score =  392 bits (996), Expect = e-109
 Identities = 206/245 (84%), Positives = 222/245 (90%), Gaps = 22/245 (8%)
 Frame = +1

Query: 127 MSPPLQLDYIGLS---------AAAGGRADD-DLKGTELRLGLPGCESPDRRPVA----- 261
           MSPPL+LDYIGLS         +AA  RADD DLKGTELRLGLPG ESPDRRP A     
Sbjct: 1   MSPPLELDYIGLSPPPPPPSSSSAAAARADDVDLKGTELRLGLPGSESPDRRPAAIAAAA 60

Query: 262 -ATTTLELLPAKGAKRGFSDEVLPPAPSAAGGKGK------ETSGDEKDKKVAAPPQPAA 420
              TTLELLPAKGAKR F DE     P+AA GKGK      E   +E+DKKVAAPPQPAA
Sbjct: 61  ATATTLELLPAKGAKRVFPDEAALTPPTAAAGKGKAAREGEEVGAEEEDKKVAAPPQPAA 120

Query: 421 KAQVVGWPPIRSYRKNTMATTTNQLKSSKEDSDAKQGQEFLYVKVSMDGAPYLRKVDLKT 600
           KAQVVGWPPIRSYRKNTMAT  NQ+KS+KED DAKQGQ FLYVKVSMDGAPYLRKVDLKT
Sbjct: 121 KAQVVGWPPIRSYRKNTMAT--NQIKSNKEDVDAKQGQGFLYVKVSMDGAPYLRKVDLKT 178

Query: 601 YKNYKDLSLGLEKMFIGFSTGKDGVSENRKDGEYVLTYEDKDGDWMLVGDVPWEMFTESC 780
           YKNYKD+SLGLEKMFIGFSTGK+G +EN+KDGEYVLTYEDKDGDWMLVGDVPWEMFT+SC
Sbjct: 179 YKNYKDMSLGLEKMFIGFSTGKEG-AENQKDGEYVLTYEDKDGDWMLVGDVPWEMFTDSC 237

Query: 781 RRLRVMKGSDAVGLAVPRAGDKSKNKN 861
           RRLR+MKGSDA+GLA PRAG+KSKN+N
Sbjct: 238 RRLRIMKGSDAIGLA-PRAGEKSKNRN 263
  9629.m01273|protein  AUX/IAA family
           Length = 263
           
 Score =  392 bits (996), Expect = e-109
 Identities = 206/245 (84%), Positives = 222/245 (90%), Gaps = 22/245 (8%)
 Frame = +1

Query: 127 MSPPLQLDYIGLS---------AAAGGRADD-DLKGTELRLGLPGCESPDRRPVA----- 261
           MSPPL+LDYIGLS         +AA  RADD DLKGTELRLGLPG ESPDRRP A     
Sbjct: 1   MSPPLELDYIGLSPPPPPPSSSSAAAARADDVDLKGTELRLGLPGSESPDRRPAAIAAAA 60

Query: 262 -ATTTLELLPAKGAKRGFSDEVLPPAPSAAGGKGK------ETSGDEKDKKVAAPPQPAA 420
              TTLELLPAKGAKR F DE     P+AA GKGK      E   +E+DKKVAAPPQPAA
Sbjct: 61  ATATTLELLPAKGAKRVFPDEAALTPPTAAAGKGKAAREGEEVGAEEEDKKVAAPPQPAA 120

Query: 421 KAQVVGWPPIRSYRKNTMATTTNQLKSSKEDSDAKQGQEFLYVKVSMDGAPYLRKVDLKT 600
           KAQVVGWPPIRSYRKNTMAT  NQ+KS+KED DAKQGQ FLYVKVSMDGAPYLRKVDLKT
Sbjct: 121 KAQVVGWPPIRSYRKNTMAT--NQIKSNKEDVDAKQGQGFLYVKVSMDGAPYLRKVDLKT 178

Query: 601 YKNYKDLSLGLEKMFIGFSTGKDGVSENRKDGEYVLTYEDKDGDWMLVGDVPWEMFTESC 780
           YKNYKD+SLGLEKMFIGFSTGK+G +EN+KDGEYVLTYEDKDGDWMLVGDVPWEMFT+SC
Sbjct: 179 YKNYKDMSLGLEKMFIGFSTGKEG-AENQKDGEYVLTYEDKDGDWMLVGDVPWEMFTDSC 237

Query: 781 RRLRVMKGSDAVGLAVPRAGDKSKNKN 861
           RRLR+MKGSDA+GLA PRAG+KSKN+N
Sbjct: 238 RRLRIMKGSDAIGLA-PRAGEKSKNRN 263
  9633.m01237|protein  AUX/IAA family
           Length = 257
           
 Score =  377 bits (959), Expect = e-104
 Identities = 203/245 (82%), Positives = 219/245 (88%), Gaps = 17/245 (6%)
 Frame = +1

Query: 127 MSPPLQLDYIGLS----AAAGGRADDDLKGTELRLGLPGCESPDRRPVAATTTLELLPA- 291
           MSPPL+LDYIGLS    AAA   AD+DLKGTELRLGLPG  SPDR P AAT  L+LLPA 
Sbjct: 1   MSPPLELDYIGLSPPVPAAADAAADNDLKGTELRLGLPGSHSPDRSPPAAT--LDLLPAA 58

Query: 292 KGAKRGFSDEVLP----PAPSAAGGKGKETSG-------DEKDKKVAAPPQ-PAAKAQVV 435
           KGAKRGFSDE  P     A +AA GKGK+ +        +E+DKKVAA PQ PAAKAQVV
Sbjct: 59  KGAKRGFSDEARPLPASAAAAAAAGKGKKAAAGEEDEDAEEEDKKVAAAPQAPAAKAQVV 118

Query: 436 GWPPIRSYRKNTMATTTNQLKSSKEDSDAKQGQEFLYVKVSMDGAPYLRKVDLKTYKNYK 615
           GWPPIRSYRKNTMAT  NQLKSSKED++AKQGQ FLYVKVSMDGAPYLRKVDLKTYKNYK
Sbjct: 119 GWPPIRSYRKNTMAT--NQLKSSKEDAEAKQGQGFLYVKVSMDGAPYLRKVDLKTYKNYK 176

Query: 616 DLSLGLEKMFIGFSTGKDGVSENRKDGEYVLTYEDKDGDWMLVGDVPWEMFTESCRRLRV 795
           DLS  LEKMFIGF+TGKDG+SE+RKDGEYVLTYEDKDGDWMLVGDVPWEMF  SCRRLR+
Sbjct: 177 DLSTALEKMFIGFTTGKDGLSESRKDGEYVLTYEDKDGDWMLVGDVPWEMFANSCRRLRI 236

Query: 796 MKGSDAVGLAVPRAGDKSKNKN 861
           MKGSDA+GLA PRA DKSKN+N
Sbjct: 237 MKGSDAIGLA-PRAVDKSKNRN 257
  9629.m04665|protein  AUX/IAA family
           Length = 271
           
 Score =  222 bits (560), Expect = 9e-58
 Identities = 137/241 (56%), Positives = 170/241 (69%), Gaps = 33/241 (13%)
 Frame = +1

Query: 127 MSPPLQL-DYIGLSAAAGGRADD------------DLKGTEL--RLGLPGCESPDRRPVA 261
           MSPPL+  DYIGLSAAA                  + +G  L  RLGLPG ESP+R  VA
Sbjct: 1   MSPPLEPHDYIGLSAAAASPTPSSSSCSSSPNPGGEARGPRLTLRLGLPGSESPEREVVA 60

Query: 262 ATTTLELLPAK----GAKRGFSDEVLPPAPSAAGGKGKETSGDEKDKKVAAPPQPAAKAQ 429
           A  TL  LP       +KR F D   P   +++G      +  +K    AAPP  AAKAQ
Sbjct: 61  AGLTLGPLPPTTTKAASKRAFPDSS-PRHGASSGSVAAAAACQDKAAPAAAPP--AAKAQ 117

Query: 430 VVGWPPIRSYRKNTMATTTNQLKSSKEDSDAKQGQEFLYVKVSMDGAPYLRKVDLKTYKN 609
           VVGWPP+R+YRKNT+A + +  K   ED    +G   LYVKVSMDGAPYLRKVDLK Y +
Sbjct: 118 VVGWPPVRNYRKNTLAASAS--KGKGEDKGTAEGGP-LYVKVSMDGAPYLRKVDLKMYSS 174

Query: 610 YKDLSLGLEKMFIGFSTGKDGV--SENR------------KDGEYVLTYEDKDGDWMLVG 747
           Y+DLS+ LEKMF  F TG+ G+  S NR            +D EYVLTYEDKD DWMLVG
Sbjct: 175 YEDLSMALEKMFSCFITGQSGLRKSSNRDRLTNGSKADALQDQEYVLTYEDKDADWMLVG 234

Query: 748 DVPWEMFTESCRRLRVMKGSDAVGLAVPRAGDKS 849
           D+PW++FT  CR+L++M+GSDA G+A PR+ ++S
Sbjct: 235 DLPWDLFTTICRKLKIMRGSDAAGIA-PRSIEQS 267
  9633.m04541|protein  AUX/IAA family
           Length = 281
           
 Score =  213 bits (536), Expect = 6e-55
 Identities = 134/244 (54%), Positives = 163/244 (65%), Gaps = 40/244 (16%)
 Frame = +1

Query: 127 MSPPLQL-DYIGLSAAAGGRADDDLKGTE----------LRLGLPGCESPDR---RPVAA 264
           M PPL+  DYIGL+A+    +      T           LRLGLPG ESP R     V  
Sbjct: 1   MPPPLEARDYIGLAASPASSSSSCCASTPVAEVVGAHLALRLGLPGSESPARAEAEAVVV 60

Query: 265 TTTLELLPAK----GAKRGFSDEVLPP----APSAAGGKGKETSGDEKDKK----VAAPP 408
              L L PA     GAKRGF D +       A + AG   +    +E+++K     AA  
Sbjct: 61  DAALTLGPAPPPRGGAKRGFVDSLDRSEGRRAAATAGDDERGVREEEEEEKGLGEAAAGA 120

Query: 409 QPAAKAQVVGWPPIRSYRKNTMATTTNQLKSSKEDSDAKQGQEFLYVKVSMDGAPYLRKV 588
             AAKAQVVGWPP+RSYRKNT+A +  + K    +   K      YVKVSMDGAPYLRKV
Sbjct: 121 PRAAKAQVVGWPPVRSYRKNTLAASATKTKG---EDQGKSEVGCCYVKVSMDGAPYLRKV 177

Query: 589 DLKTYKNYKDLSLGLEKMFIGFSTGK-------------DGV-SENRKDGEYVLTYEDKD 726
           DLKTY +Y+DLSL LEKMF  F TG+             DG  ++  KD EYVLTYEDKD
Sbjct: 178 DLKTYSSYEDLSLALEKMFSCFITGRSSSHKTSKRDRLTDGSRADALKDQEYVLTYEDKD 237

Query: 727 GDWMLVGDVPWEMFTESCRRLRVMKGSDAVGLAVPRAGDKSKNK 858
            DWMLVGD+PW++FT SCR+LR+M+GSDA G+A        +NK
Sbjct: 238 ADWMLVGDLPWDLFTTSCRKLRIMRGSDAAGMAPRSLEQTGQNK 281
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87339948 Number of Sequences: 59712 Number of extensions: 3220893 Number of successful extensions: 79081 Number of sequences better than 1.0e-10: 55 Number of HSP's better than 0.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 18 Number of HSP's that attempted gapping in prelim test: 78950 Number of HSP's gapped (non-prelim): 52 length of query: 393 length of database: 26,991,925 effective HSP length: 51 effective length of query: 341 effective length of database: 23,946,613 effective search space: 8165795033 effective search space used: 8165795033 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG326   Members:280            3pri:Y   1e-130      
AAN86274.1       non-cell-autonomous heat shock cognate protein 70
[Cucurbita maxima]
         (2282 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9639.m04467|protein  dnaK-type molecular chaperone hsp70 -...  1230  0.0
 9631.m05972|protein  heat shock protein cognate 70             1225  0.0
 9633.m03578|protein  dnaK protein                              1217  0.0
 9631.m01647|protein  dnaK protein                              1217  0.0
 9629.m06146|protein  dnaK protein                              1215  0.0
 9631.m01656|protein  heat shock cognate 70 kda protein         1157  0.0
 9639.m04468|protein  dnaK-type molecular chaperone hsp70 -...  1119  0.0
 9633.m03577|protein  dnaK protein                              1052  0.0
 9630.m00144|protein  dnaK-type molecular chaperone BiP - rice   831  0.0
 9633.m03294|protein  luminal binding protein 5 precursor (...   786  0.0
 9631.m04907|protein  putative luminal binding protein           781  0.0
 9631.m01650|protein  dnaK protein                               778  0.0
 9636.m04621|protein  BiP-isoform D                              764  0.0
 9633.m02768|protein  luminal binding protein 4 precursor (...   738  0.0
 9639.m00793|protein  dnaK protein, putative                     644  0.0
 9629.m04774|protein  dnaK protein                               571  e-162
 9639.m00795|protein  Similar to dnaK-type molecular chaper...   570  e-162
 9630.m05282|protein  dnaK protein                               566  e-161
 9631.m00134|protein  dnaK protein                               559  e-159
 9639.m00796|protein  Similar to hsp70                           555  e-157

  9639.m04467|protein  dnaK-type molecular chaperone hsp70 - rice
            (fragment)
            Length = 649
            
 Score = 1230 bits (3147), Expect = 0.0
 Identities = 611/647 (94%), Positives = 634/647 (97%), Gaps = 2/647 (0%)
 Frame = +3

Query: 96   MAAKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN 275
            MA KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct: 1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN 60

Query: 276  QVAMNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAA 455
            QVAMNPINTVFDAKRLIGRRF+D++VQSDIKLWPFKV+AGPGDKPMI VQYKGEEKQFAA
Sbjct: 61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA 120

Query: 456  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP 635
            EEISSMVLIKMREIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEP
Sbjct: 121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP 180

Query: 636  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 815
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
Sbjct: 181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240

Query: 816  NRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGIDFY 995
            NRMVNHFVQEFKRKNKKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGIDFY
Sbjct: 241  NRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY 300

Query: 996  STITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF 1175
            STITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQDFF
Sbjct: 301  STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQDFF 360

Query: 1176 NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI 1355
            NGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
Sbjct: 361  NGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI 420

Query: 1356 PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI 1535
            PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
Sbjct: 421  PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI 480

Query: 1536 TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK 1715
            TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK
Sbjct: 481  TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK 540

Query: 1716 KVESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEEAIDAAIQWLDTNQLAEADEFED 1895
            KVESKNALENY+YNMRNTIKDEKIASKLPA DKKKIE+AID AIQWLD NQLAEADEF+D
Sbjct: 541  KVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDD 600

Query: 1896 KMKELEALCNPIIAKMYQGAGADMEGGMDDD--TPAASGGPGPKIEEVD 2036
            KMKELE +CNPIIAKMYQGAGADM GGMD+D   PA   G GPKIEEVD
Sbjct: 601  KMKELEGICNPIIAKMYQGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD 649
  9631.m05972|protein  heat shock protein cognate 70
            Length = 649
            
 Score = 1225 bits (3134), Expect = 0.0
 Identities = 605/644 (93%), Positives = 633/644 (97%), Gaps = 1/644 (0%)
 Frame = +3

Query: 105  KGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA 284
            KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVA
Sbjct: 5    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA 64

Query: 285  MNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAAEEI 464
            MNPINTVFDAKRLIGRRF+D++VQSDIK+WP+KV+ GPGDKPMI VQYKGEEKQF+AEEI
Sbjct: 65   MNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEI 124

Query: 465  SSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEPTAA 644
            SSMVLIKMREIAEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEPTAA
Sbjct: 125  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA 184

Query: 645  AIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRM 824
            AIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR+
Sbjct: 185  AIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL 244

Query: 825  VNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGIDFYSTI 1004
            VNHFVQEFKRK+KKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEG+DFYSTI
Sbjct: 245  VNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGVDFYSTI 304

Query: 1005 TRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGK 1184
            TRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQDFFNGK
Sbjct: 305  TRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFFNGK 364

Query: 1185 ELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRN 1364
            ELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRN
Sbjct: 365  ELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRN 424

Query: 1365 TTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVC 1544
            TTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVC
Sbjct: 425  TTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVC 484

Query: 1545 FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVE 1724
            FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDEEHKKKV+
Sbjct: 485  FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVD 544

Query: 1725 SKNALENYSYNMRNTIKDEKIASKLPADDKKKIEEAIDAAIQWLDTNQLAEADEFEDKMK 1904
            +KN+LENY+YNMRNTI+DEKIASKLPADDKKKIE+A++ AIQWLD NQLAE +EFEDKMK
Sbjct: 545  AKNSLENYAYNMRNTIQDEKIASKLPADDKKKIEDAVEQAIQWLDNNQLAEVEEFEDKMK 604

Query: 1905 ELEALCNPIIAKMYQGAGADMEGGMDDDTPAASG-GPGPKIEEVD 2036
            ELE LCNPIIAKMYQGAGADM GGMDDD PAA G G GPKIEEVD
Sbjct: 605  ELEGLCNPIIAKMYQGAGADMGGGMDDDAPAAGGSGAGPKIEEVD 649
  9633.m03578|protein  dnaK protein
            Length = 646
            
 Score = 1217 bits (3115), Expect = 0.0
 Identities = 601/645 (93%), Positives = 627/645 (97%)
 Frame = +3

Query: 102  AKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV 281
            +KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQV
Sbjct: 2    SKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 61

Query: 282  AMNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAAEE 461
            AMNP NTVFDAKRLIGRRF+D +VQSD+KLWPFKVV GPGDKPMI VQYKGEEKQFAAEE
Sbjct: 62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAEE 121

Query: 462  ISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEPTA 641
            ISSMVLIKMREIAEA+LGS++KNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEPTA
Sbjct: 122  ISSMVLIKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA 181

Query: 642  AAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR 821
            AAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct: 182  AAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR 241

Query: 822  MVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGIDFYST 1001
            MVNHFVQEFKRKNKKDISGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGIDFY+T
Sbjct: 242  MVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTT 301

Query: 1002 ITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNG 1181
            ITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQDFFNG
Sbjct: 302  ITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNG 361

Query: 1182 KELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPR 1361
            KELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPR
Sbjct: 362  KELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPR 421

Query: 1362 NTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITV 1541
            NTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQI V
Sbjct: 422  NTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQINV 481

Query: 1542 CFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKV 1721
            CFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDEEHKKKV
Sbjct: 482  CFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKV 541

Query: 1722 ESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEEAIDAAIQWLDTNQLAEADEFEDKM 1901
            ++KNALENY+YNMRNTIKDEKIASKL ADDKK+IE+AID AI WLDTNQLAEADEFEDKM
Sbjct: 542  DAKNALENYAYNMRNTIKDEKIASKLAADDKKRIEDAIDGAISWLDTNQLAEADEFEDKM 601

Query: 1902 KELEALCNPIIAKMYQGAGADMEGGMDDDTPAASGGPGPKIEEVD 2036
            KELE +CNPIIAKMYQG GADM GGMD+D PA   G GPKIEEVD
Sbjct: 602  KELEGICNPIIAKMYQGPGADMAGGMDEDAPAGGSGAGPKIEEVD 646
  9631.m01647|protein  dnaK protein
            Length = 650
            
 Score = 1217 bits (3114), Expect = 0.0
 Identities = 601/647 (92%), Positives = 633/647 (96%), Gaps = 3/647 (0%)
 Frame = +3

Query: 96   MAAKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN 275
            MA KGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
Sbjct: 1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN 60

Query: 276  QVAMNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAA 455
            QVAMNPINTVFDAKRLIGRRF+D++VQSD KLWPFKV+ GPGDKPMI VQYKGEEKQF+A
Sbjct: 61   QVAMNPINTVFDAKRLIGRRFSDTSVQSDAKLWPFKVLPGPGDKPMIGVQYKGEEKQFSA 120

Query: 456  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP 635
            EEISSMVL KM+E AEA+LGSTVKNAVVTVPAYFNDSQRQATKDAGVI+G+NV+RIINEP
Sbjct: 121  EEISSMVLNKMKETAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP 180

Query: 636  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 815
            TAAAIAYGLDKK+SSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
Sbjct: 181  TAAAIAYGLDKKSSSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240

Query: 816  NRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGIDFY 995
            NRMVNHFVQEFKRKNKKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGIDFY
Sbjct: 241  NRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY 300

Query: 996  STITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF 1175
            +TITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIP+VQQLLQDFF
Sbjct: 301  TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFF 360

Query: 1176 NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI 1355
            NGKELCKSINPDEAVAYGAAVQAAIL+GEGNEKVQDLLLLDVTPLS GLETAGGVMTVLI
Sbjct: 361  NGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLI 420

Query: 1356 PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI 1535
            PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQI
Sbjct: 421  PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQI 480

Query: 1536 TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK 1715
            TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK+EDEEHKK
Sbjct: 481  TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKK 540

Query: 1716 KVESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEEAIDAAIQWLDTNQLAEADEFED 1895
            KV++KN+LENY+YNMRNTIKD+KIASKLP  DKKKIE+AID AI WLD+NQLAEA+EFED
Sbjct: 541  KVDAKNSLENYAYNMRNTIKDDKIASKLPEADKKKIEDAIDGAISWLDSNQLAEAEEFED 600

Query: 1896 KMKELEALCNPIIAKMYQGAGADMEGGMDDDTPAASG---GPGPKIEEVD 2036
            KMKELE +CNPIIAKMYQGAGADM GGMD+D PAA+G   GPGPKIEEVD
Sbjct: 601  KMKELEGVCNPIIAKMYQGAGADMAGGMDEDAPAAAGGSSGPGPKIEEVD 650
  9629.m06146|protein  dnaK protein
            Length = 648
            
 Score = 1215 bits (3110), Expect = 0.0
 Identities = 603/645 (93%), Positives = 629/645 (97%), Gaps = 2/645 (0%)
 Frame = +3

Query: 102  AKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV 281
            AKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV
Sbjct: 2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV 61

Query: 282  AMNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAAEE 461
            AMNPINTVFDAKRLIGRRF+D +VQSD+KLWPFKV+ GPGDKPMI VQYKGEEKQF+AEE
Sbjct: 62   AMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEE 121

Query: 462  ISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEPTA 641
            ISSMVLIKMREIAEA+LGS +KNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEPTA
Sbjct: 122  ISSMVLIKMREIAEAYLGSNIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA 181

Query: 642  AAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR 821
            AAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct: 182  AAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR 241

Query: 822  MVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGIDFYST 1001
            MVNHFV EFKRKNKKDISGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGIDFYST
Sbjct: 242  MVNHFVLEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYST 301

Query: 1002 ITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNG 1181
            ITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQDFFNG
Sbjct: 302  ITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNG 361

Query: 1182 KELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPR 1361
            KELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPR
Sbjct: 362  KELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPR 421

Query: 1362 NTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITV 1541
            NTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITV
Sbjct: 422  NTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITV 481

Query: 1542 CFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKV 1721
            CFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDEEHKKKV
Sbjct: 482  CFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKV 541

Query: 1722 ESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEEAIDAAIQWLDTNQLAEADEFEDKM 1901
            ++KNALENY+YNMRNTIKD+KIASKL ADDKKKIE+AID AI WLD+NQLAEADEFEDKM
Sbjct: 542  DAKNALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIDGAINWLDSNQLAEADEFEDKM 601

Query: 1902 KELEALCNPIIAKMYQGAGADMEG--GMDDDTPAASGGPGPKIEEVD 2036
            KELE++CNPIIAKMYQGAGADM G  GMD+D PA   G GPKIEEVD
Sbjct: 602  KELESICNPIIAKMYQGAGADMGGAAGMDEDAPAGGSGAGPKIEEVD 648
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 154788981 Number of Sequences: 59712 Number of extensions: 4744596 Number of successful extensions: 32762 Number of sequences better than 1.0e-10: 53 Number of HSP's better than 0.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 32586 Number of HSP's gapped (non-prelim): 53 length of query: 760 length of database: 26,991,925 effective HSP length: 53 effective length of query: 707 effective length of database: 23,827,189 effective search space: 16845822623 effective search space used: 16845822623 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 162 (67.5 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG374   Members:69             3pri:Y   1e-115      
T06801           probable superoxide dismutase (EC 1.15.1.1) (Mn)
precursor - wheat gb|AAB68036.1| manganese superoxide dismuta
         (1148 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9633.m02330|protein  probable superoxide dismutase (EC 1.1...   411  e-114
 9634.m00431|protein  superoxide dismutase (EC 1.15.1.1) (F...   114  3e-25
 9634.m00430|protein  superoxide dismutase (EC 1.15.1.1) (F...   114  3e-25
 9634.m00154|protein  Iron/manganese superoxide dismutases,...    96  1e-19
 9634.m00155|protein  Iron/manganese superoxide dismutases,...    69  1e-11

  9633.m02330|protein  probable superoxide dismutase (EC 1.15.1.1)
           (Mn) precursor - rice
           Length = 231
           
 Score =  411 bits (1044), Expect = e-114
 Identities = 195/226 (86%), Positives = 205/226 (90%), Gaps = 5/226 (2%)
 Frame = +3

Query: 51  MALRTLATKRTLG-----LALGGARRGVATFTLPDLPYDYGALEPAVSGEIMRLHHQKHH 215
           MALRTLA+++TL      LA   A RGV T  LPDLPYDYGALEPA+SGEIMRLHHQKHH
Sbjct: 1   MALRTLASRKTLAAAALPLAAAAAARGVTTVALPDLPYDYGALEPAISGEIMRLHHQKHH 60

Query: 216 ATYVANYNKALEQLDAAVGKGDASGVVHLQSAIKFNGGGHVNHSIFWKNLKPISEGGGEP 395
           ATYVANYNKALEQLDAAV KGDA  +VHLQSAIKFNGGGHVNHSIFW NLKPISEGGG+P
Sbjct: 61  ATYVANYNKALEQLDAAVAKGDAPAIVHLQSAIKFNGGGHVNHSIFWNNLKPISEGGGDP 120

Query: 396 PHGKLGWAIDEDFGSIEKLIKKMNAEGAALQGSGWVWLALDKEAKKLSVETTPNQDPLVT 575
           PH KLGWAIDEDFGS E L+KKM+AEGAALQGSGWVWLALDKEAKKLSVETT NQDPLVT
Sbjct: 121 PHAKLGWAIDEDFGSFEALVKKMSAEGAALQGSGWVWLALDKEAKKLSVETTANQDPLVT 180

Query: 576 KGANLYPLLGIDVWEHAYYLQYKNVRPDYLTNIWKVVNWKYAGEEYEKVLA 728
           KGANL PLLGIDVWEHAYYLQYKNVRPDYL+NIWKV+NWKYAGE YE   A
Sbjct: 181 KGANLVPLLGIDVWEHAYYLQYKNVRPDYLSNIWKVMNWKYAGEVYENATA 231
  9634.m00431|protein  superoxide dismutase (EC 1.15.1.1) (Fe) - rice
           Length = 255
           
 Score =  114 bits (283), Expect = 3e-25
 Identities = 74/192 (38%), Positives = 104/192 (53%), Gaps = 9/192 (4%)
 Frame = +3

Query: 117 VATFTLPDLPYDYGALEPAVSGEIMRLHHQKHHATYVANYNKALEQ-------LDAAVGK 275
           VA + L   PY   ALEP +S   + LH  KH   YV + NK L         L+  + +
Sbjct: 40  VAYYALTTPPYKLDALEPYISKRTVELHWGKHQQDYVDSLNKQLATSMFYGYTLEELIKE 99

Query: 276 GDASGVVHLQSAIKFNGGGHV-NHSIFWKNLKPISEGGGEPPHGKLGWAIDEDFGSIEKL 452
              +G        ++N    V NH  FW++++P  EGGG P  G L   I++DFGS    
Sbjct: 100 AYNNG----NPLPEYNNAAQVWNHHFFWESMQP--EGGGSPGRGVLQ-QIEKDFGSFTNF 152

Query: 453 IKKMNAEGAALQGSGWVWLALDKEAKKLSVETTPNQDPLVTKGANLYPLLGIDVWEHAYY 632
            ++      +L GSGWVWL L ++ +K SV  T N    +  G    PL+ +D+WEHAYY
Sbjct: 153 REEFIRSALSLLGSGWVWLVLKRKERKFSVVHTQNAISPLALGD--IPLINLDLWEHAYY 210

Query: 633 LQYKNVRPDYLTN-IWKVVNW 692
           L YK+ R  Y+TN I  +V+W
Sbjct: 211 LDYKDDRRMYVTNFIDHLVSW 231
  9634.m00430|protein  superoxide dismutase (EC 1.15.1.1) (Fe) - rice
           Length = 255
           
 Score =  114 bits (283), Expect = 3e-25
 Identities = 74/192 (38%), Positives = 104/192 (53%), Gaps = 9/192 (4%)
 Frame = +3

Query: 117 VATFTLPDLPYDYGALEPAVSGEIMRLHHQKHHATYVANYNKALEQ-------LDAAVGK 275
           VA + L   PY   ALEP +S   + LH  KH   YV + NK L         L+  + +
Sbjct: 40  VAYYALTTPPYKLDALEPYISKRTVELHWGKHQQDYVDSLNKQLATSMFYGYTLEELIKE 99

Query: 276 GDASGVVHLQSAIKFNGGGHV-NHSIFWKNLKPISEGGGEPPHGKLGWAIDEDFGSIEKL 452
              +G        ++N    V NH  FW++++P  EGGG P  G L   I++DFGS    
Sbjct: 100 AYNNG----NPLPEYNNAAQVWNHHFFWESMQP--EGGGSPGRGVLQ-QIEKDFGSFTNF 152

Query: 453 IKKMNAEGAALQGSGWVWLALDKEAKKLSVETTPNQDPLVTKGANLYPLLGIDVWEHAYY 632
            ++      +L GSGWVWL L ++ +K SV  T N    +  G    PL+ +D+WEHAYY
Sbjct: 153 REEFIRSALSLLGSGWVWLVLKRKERKFSVVHTQNAISPLALGD--IPLINLDLWEHAYY 210

Query: 633 LQYKNVRPDYLTN-IWKVVNW 692
           L YK+ R  Y+TN I  +V+W
Sbjct: 211 LDYKDDRRMYVTNFIDHLVSW 231
  9634.m00154|protein  Iron/manganese superoxide dismutases,
           alpha-hairpin domain, putative
           Length = 391
           
 Score = 96.0 bits (235), Expect = 1e-19
 Identities = 72/195 (36%), Positives = 110/195 (55%), Gaps = 31/195 (15%)
 Frame = +3

Query: 141 LPYDYGALEPAVSGEIMRLHHQKHHATYVANYNKALEQLDAAVGKGDASGVVHLQSAIK- 317
           LPY   ALEP +S E +  H   H   +V       E+L+  +G  +  G+   Q  +  
Sbjct: 129 LPYPSDALEPYISKETVEQHWGVHQNIHV-------ERLNGMIGGSEWEGMSLGQMMLSS 181

Query: 318 FNGGGHV------------NHSIFWKNLKPISEGGGEPPHGKLGWAIDEDFGSIEKLIKK 461
           FN G               NH  +W++++P   GGG+PP   L + I+ DFGS + +I++
Sbjct: 182 FNEGREAPHPPFFHAAQIWNHDFYWRSMQP--GGGGKPPERLLKF-INRDFGSYDGMIRQ 238

Query: 462 MNAEGAALQGSGWVWLALDKEAK----------------KLSVETTPNQ-DPLVTKGANL 590
                +   GSGWVWL   K +K                +L +  +PN  +PLV   +  
Sbjct: 239 FMDAASTQFGSGWVWLCY-KTSKLPHVKSRSPIPSDNYGRLVISKSPNAINPLVWGHS-- 295

Query: 591 YPLLGIDVWEHAYYLQYKNVRPDYL-TNIWKVVNWKYAGEEYEKVL 725
            PLL ID+WEHAYYL Y++ R DY+ T + K+V+W+      +K +
Sbjct: 296 -PLLAIDLWEHAYYLDYEDRRSDYVSTFLEKLVSWETVESRLKKAV 340
  9634.m00155|protein  Iron/manganese superoxide dismutases,
           alpha-hairpin domain, putative
           Length = 305
           
 Score = 69.5 bits (167), Expect = 1e-11
 Identities = 58/160 (36%), Positives = 87/160 (54%), Gaps = 30/160 (18%)
 Frame = +3

Query: 141 LPYDYGALEPAVSGEIMRLHHQKHHATYVANYNKALEQLDAAVGKGDASGVVHLQSAIK- 317
           LPY   ALEP +S E +  H   H   +V       E+L+  +G  +  G+   Q  +  
Sbjct: 129 LPYPSDALEPYISKETVEQHWGVHQNIHV-------ERLNGMIGGSEWEGMSLGQMMLSS 181

Query: 318 FNGGGHV------------NHSIFWKNLKPISEGGGEPPHGKLGWAIDEDFGSIEKLIKK 461
           FN G               NH  +W++++P   GGG+PP   L + I+ DFGS + +I++
Sbjct: 182 FNEGREAPHPPFFHAAQIWNHDFYWRSMQP--GGGGKPPERLLKF-INRDFGSYDGMIRQ 238

Query: 462 MNAEGAALQGSGWVWLALDKEAK----------------KLSVETTPNQ-DPLVTKGANL 590
                +   GSGWVWL   K +K                +L +  +PN  +PLV   +  
Sbjct: 239 FMDAASTQFGSGWVWLCY-KTSKLPHVKSRSPIPSDNYGRLVISKSPNAINPLVWGHS-- 295

Query: 591 YPLLGIDVWE 620
            PLL ID+WE
Sbjct: 296 -PLLAIDLWE 304
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75760850 Number of Sequences: 59712 Number of extensions: 2254527 Number of successful extensions: 23397 Number of sequences better than 1.0e-10: 10 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 23383 Number of HSP's gapped (non-prelim): 5 length of query: 382 length of database: 26,991,925 effective HSP length: 51 effective length of query: 331 effective length of database: 23,946,613 effective search space: 7926328903 effective search space used: 7926328903 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG383   Members:160            3pri:Y   5e-52       
Q40070           Photosystem II 10 kDa polypeptide, chloroplast
precursor pir||T06173 photosystem II 10K protein precursor - ba
         (2260 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9631.m00830|protein expressed protein                           318  2e-86
 9635.m00472|protein  hypothetical protein                       233  1e-60
 9636.m00961|protein  photosystem II 10K protein - rice          157  9e-38

  9631.m00830|protein expressed protein
            Length = 1178
            
 Score =  318 bits (807), Expect = 2e-86
 Identities = 169/244 (69%), Positives = 195/244 (79%), Gaps = 1/244 (0%)
 Frame = -1

Query: 733  VKNVADYQSSGRYLLKPELEVENSNHASGSGRTIDENIEEIAPSLRIDDPDIFEKIEIGG 554
            +KN+A +Q+ GRYLLKP LE E+S       R+ID+N EE  PSL++DDPDIFE+I+IGG
Sbjct: 335  IKNIAIFQAPGRYLLKPGLEAESSK------RSIDDNTEEAGPSLKMDDPDIFERIDIGG 388

Query: 553  SPVSAAGDEKVH-DSDAKAGTSSESGSDSDSDSDSSGSGSDSGSQSRSAGSGSGSSSDSD 377
            SPVSAA DEKV+ DSD KAG+SSESGS SDSDS+SS SGSDSGSQSRSA SGSGSSSDSD
Sbjct: 389  SPVSAARDEKVNNDSDGKAGSSSESGSGSDSDSESSDSGSDSGSQSRSAASGSGSSSDSD 448

Query: 376  SDASSSSKEGSDAFVDITSDDNKPDTACRKVADELKLSSSPVDFPAFDGDDEQIDIGTNL 197
            SDASSSSKEGSDAFVDITSDD+K   A RK ADELKLSS P D  A DGDDE IDIGTNL
Sbjct: 449  SDASSSSKEGSDAFVDITSDDDKGG-AHRKAADELKLSSLPRDLTALDGDDELIDIGTNL 507

Query: 196  DYKSASSHIDLNNLNVDNDEPAYAGTATEKFGASNVDMPSEFPGRENMVSTRLDQSIVDG 17
            DYKSAS HIDLNN N +N+E AY    T+ F AS+++ P E PG +NMV+T +D S +D 
Sbjct: 508  DYKSASPHIDLNNFNDNNNESAYTAVPTDSFDASHLEKPPEIPGSKNMVNTSIDPSRIDS 567

Query: 16   KYPAS 2
            KY A+
Sbjct: 568  KYAAN 572
  9635.m00472|protein  hypothetical protein
            Length = 137
            
 Score =  233 bits (588), Expect = 1e-60
 Identities = 112/137 (81%), Positives = 126/137 (91%)
 Frame = +2

Query: 791  MSACVMASLALKPSSSPLLQRSKLGGVRPSARPSLVIVAKKAKKVQTAQPYGPGGGVAFK 970
            M+A VMASLALKPS+SPLL+RSKL G    ARPSL+IVAKKAKK+QT+QPYGP GGV FK
Sbjct: 1    MAASVMASLALKPSASPLLERSKLRGKGTMARPSLIIVAKKAKKIQTSQPYGPAGGVVFK 60

Query: 971  EGVDASGRVAKGKGVYQFADKYGANVDGYSPIYTPEEWSPSGDVYVGGKTGLFLWAVTLA 1150
            EGVDASGRVAKGKG+YQF++KYGANVDGYSPIYTPEEWS +GDVYVGGK GL LWA+TLA
Sbjct: 61   EGVDASGRVAKGKGLYQFSNKYGANVDGYSPIYTPEEWSSTGDVYVGGKAGLLLWAITLA 120

Query: 1151 GILLGGALLVYSTSALA 1201
            GIL+GGA+LVY+TSALA
Sbjct: 121  GILVGGAILVYNTSALA 137
  9636.m00961|protein  photosystem II 10K protein - rice
            Length = 130
            
 Score =  157 bits (392), Expect = 9e-38
 Identities = 79/129 (61%), Positives = 98/129 (75%), Gaps = 2/129 (1%)
 Frame = +2

Query: 815  LALKPSSSPLLQRSKLGGVRPSAR--PSLVIVAKKAKKVQTAQPYGPGGGVAFKEGVDAS 988
            +A    +SPL+  ++  G+   +R   S  IV    KK++T +PYG GGG++    +DAS
Sbjct: 1    MATSMITSPLVAPARAKGLPSISRRGSSFAIVCSGGKKIKTDKPYGIGGGMSVD--IDAS 58

Query: 989  GRVAKGKGVYQFADKYGANVDGYSPIYTPEEWSPSGDVYVGGKTGLFLWAVTLAGILLGG 1168
            GR + GKGVYQF DKYGANVDGYSPIY+PEEWSP+GD YVGG TGL +WAVTLAG+L GG
Sbjct: 59   GRKSTGKGVYQFVDKYGANVDGYSPIYSPEEWSPTGDTYVGGTTGLLIWAVTLAGLLGGG 118

Query: 1169 ALLVYSTSALA 1201
            ALLVY+TSALA
Sbjct: 119  ALLVYNTSALA 129
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 120873292 Number of Sequences: 59712 Number of extensions: 3065500 Number of successful extensions: 18789 Number of sequences better than 1.0e-10: 6 Number of HSP's better than 0.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 18757 Number of HSP's gapped (non-prelim): 5 length of query: 753 length of database: 26,991,925 effective HSP length: 53 effective length of query: 699 effective length of database: 23,827,189 effective search space: 16655205111 effective search space used: 16655205111 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 162 (67.5 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG388   Members:22             3pri:Y   1e-116      
CAD29296.1       plasma membrane H+ ATPase [Oryza sativa (japonica
cultivar-group)]
         (2665 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9640.m04351|protein  plasma-membrane proton-efflux P-type ...  1414  0.0
 9631.m04701|protein  plasma-membrane proton-efflux P-type ...  1366  0.0
 9635.m00896|protein  plasma-membrane proton-efflux P-type ...  1323  0.0
 9632.m05471|protein  plasma-membrane proton-efflux P-type ...  1206  0.0
 9631.m00012|protein  plasma-membrane proton-efflux P-type ...  1165  0.0
 9630.m05505|protein  plasma-membrane proton-efflux P-type ...  1148  0.0
 9633.m02301|protein  plasma-membrane proton-efflux P-type ...  1131  0.0
 9636.m01434|protein  plasma-membrane proton-efflux P-type ...  1104  0.0
 9634.m00768|protein  plasma-membrane proton-efflux P-type ...  1009  0.0
 9634.m00767|protein  plasma-membrane proton-efflux P-type ...  1009  0.0
 9631.m00801|protein  plasma-membrane proton-efflux P-type ...   972  0.0
 9639.m02667|protein  E1-E2 ATPase, putative                     295  3e-79
 9639.m02689|protein  E1-E2 ATPase, putative                     259  2e-68
 9629.m07280|protein  hypothetical protein                       208  5e-53
 9640.m00336|protein  calcium-translocating P-type ATPase, ...   145  4e-34
 9632.m04989|protein  calcium-translocating P-type ATPase, ...   143  2e-33
 9632.m04988|protein  calcium-translocating P-type ATPase, ...   143  2e-33
 9633.m03896|protein  calcium-translocating P-type ATPase, ...   142  2e-33
 9630.m00757|protein  calcium-translocating P-type ATPase, ...   133  1e-30
 9631.m00071|protein  E1-E2 ATPase, putative                     130  1e-29

  9640.m04351|protein  plasma-membrane proton-efflux P-type ATPase
            Length = 956
            
 Score = 1414 bits (3619), Expect(2) = 0.0
 Identities = 703/737 (95%), Positives = 721/737 (97%)
 Frame = +3

Query: 36   YTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVGMFIEIIVMYPIQHRAYRPGIDN 215
            +TFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVGMF+EIIVMYPIQHRAYRPGIDN
Sbjct: 221  HTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVGMFVEIIVMYPIQHRAYRPGIDN 280

Query: 216  LLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTL 395
            LLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTL
Sbjct: 281  LLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTL 340

Query: 396  NKLTVDKSLVEVFERGITQDQVILMAARASRTENQDAIDTAIVGMLADPKEARAGIQEVH 575
            NKLTVDK+L++VFERGITQDQVILMAARASRTENQDAIDTAIVGMLADPKEARAGIQEVH
Sbjct: 341  NKLTVDKNLIDVFERGITQDQVILMAARASRTENQDAIDTAIVGMLADPKEARAGIQEVH 400

Query: 576  FLPFNPTDKRTALTYIDADGKMHRVSKGAPEQILHLAHNTSEIERRVHAVIDKFAERGLR 755
            FLPFNPTDKRTALTYID DGKM+RVSKGAPEQILHLAHN  EIERRVHAVIDKFAERGLR
Sbjct: 401  FLPFNPTDKRTALTYIDGDGKMYRVSKGAPEQILHLAHNKPEIERRVHAVIDKFAERGLR 460

Query: 756  SLAVAYQEVPDGRKESPGGPWHFAGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLA 935
            SLAVAYQEVP+G KESPGGPWHF GLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLA
Sbjct: 461  SLAVAYQEVPEGTKESPGGPWHFVGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLA 520

Query: 936  IGKETGRRLGMGTNMYPSSALLGQKNSDESISALPVDDLIEKADGFAGVFPEHKYEIVKR 1115
            IGKETGRRLGMGTNMYPSSALLGQ N DESI+ALPVDDLIEKADGFAGVFPEHKYEIVKR
Sbjct: 521  IGKETGRRLGMGTNMYPSSALLGQ-NKDESIAALPVDDLIEKADGFAGVFPEHKYEIVKR 579

Query: 1116 LQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTS 1295
            LQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTS
Sbjct: 580  LQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTS 639

Query: 1296 RAIFQRMKNYTIYAVSITIRIVLGFMLLALIWNFDFPPFMVLIIAILNDGTIMTISKDRV 1475
            RAIFQRMKNYTIYAVSITIRIVLGFMLLALIW FDFPPFMVLIIAILNDGTIMTISKDRV
Sbjct: 640  RAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMVLIIAILNDGTIMTISKDRV 699

Query: 1476 KPSPLPDSWKLAEIFTTGVILGGYLAIMTVIFFWAAYKTNFFPRLFHVESLEKTAQDDFQ 1655
            KPSPLPDSWKLAEIFTTGV+LGGYLA+MTVIFFWAAYKT+FFPR+FHVESLEKTAQDDFQ
Sbjct: 700  KPSPLPDSWKLAEIFTTGVVLGGYLAMMTVIFFWAAYKTDFFPRIFHVESLEKTAQDDFQ 759

Query: 1656 KLASAIYLQVSTISQALIFVTRSRSWSFAERPGFLLVFAFFVAQLIATLIAVYADWKFAA 1835
            KLASA+YLQVSTISQALIFVTRSRSWSF ERPGFLLVFAF VAQLIATLIAVYADW F +
Sbjct: 760  KLASAVYLQVSTISQALIFVTRSRSWSFVERPGFLLVFAFLVAQLIATLIAVYADWAFTS 819

Query: 1836 IKGIGWGWAGVVWLYNIITYFPLDIIKFLIRYTLSGKAWDLVIDQRIAFTRKKDFGKEER 2015
            IKGIGWGWAG+VWLYN+I YFPLDIIKFLIRY LSGKAWDLVI+QRIAFTRKKDFGKEER
Sbjct: 820  IKGIGWGWAGIVWLYNLIFYFPLDIIKFLIRYALSGKAWDLVIEQRIAFTRKKDFGKEER 879

Query: 2016 ELKWAHAQRTLHGLQPPDAKMFSDKGGYNELNHMAEEAKRRAEIARLRELHTLKGHVESV 2195
            ELKWAHAQRTLHGLQPPDAKMFS+K GYNELN MAEEAKRRAEIARLRELHTLKGHVESV
Sbjct: 880  ELKWAHAQRTLHGLQPPDAKMFSEKAGYNELNQMAEEAKRRAEIARLRELHTLKGHVESV 939

Query: 2196 VKLKGLDIETIQQSYTV 2246
            VKLKGLDIETIQQSYTV
Sbjct: 940  VKLKGLDIETIQQSYTV 956
 Score = 25.4 bits (54), Expect(2) = 0.0
 Identities = 11/12 (91%), Positives = 12/12 (99%)
 Frame = +1

Query: 1   GEIEAVVIATGV 36
           GEIEA+VIATGV
Sbjct: 209 GEIEAIVIATGV 220
  9631.m04701|protein  plasma-membrane proton-efflux P-type ATPase
            Length = 1000
            
 Score = 1366 bits (3497), Expect(2) = 0.0
 Identities = 688/737 (93%), Positives = 716/737 (96%), Gaps = 39/737 (5%)
 Frame = +3

Query: 36   YTFFGKAAHLVDSTNQVGHFQK----------VLTAIGNFCICSIAVGMFIEIIVMYPIQ 185
            +TFFGKAAHLVDSTNQVGHFQK          VLTAIGNFCICSIAVGMF+EIIVMYPIQ
Sbjct: 226  HTFFGKAAHLVDSTNQVGHFQKARLRSLTSVHVLTAIGNFCICSIAVGMFVEIIVMYPIQ 285

Query: 186  HRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVL 365
            HR YRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVL
Sbjct: 286  HRPYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVL 345

Query: 366  CSDKTGTLTLNKLTVDKSLVEVFERGITQDQVILMAARASRTENQDAIDTAIVGMLADPK 545
            CSDKTGTLTLNKLTVDK+L+E+FERG+TQDQVILMAARASRTENQDAIDTAIVGMLADPK
Sbjct: 346  CSDKTGTLTLNKLTVDKNLIEIFERGVTQDQVILMAARASRTENQDAIDTAIVGMLADPK 405

Query: 546  EARAGIQEVHFLPFNPTDKRTALTYIDADGKMHRVSKGAPEQILHLAHNTSEIERRVHAV 725
            EARAGIQEVHFLPFNPTDKRTALTYID+DGKM+RVSKGAPEQIL+LAHN ++IERRVHAV
Sbjct: 406  EARAGIQEVHFLPFNPTDKRTALTYIDSDGKMYRVSKGAPEQILNLAHNKTQIERRVHAV 465

Query: 726  IDKFAERGLRSLAVAYQEVPDGRKESPGGPWHFAGLMPLFDPPRHDSAETIRRALNLGVN 905
            IDKFAERGLRSLAVAYQEVPDGRKESPGGPW F  L+PLFDPPRHDSAETIRRALNLGVN
Sbjct: 466  IDKFAERGLRSLAVAYQEVPDGRKESPGGPWRFVALLPLFDPPRHDSAETIRRALNLGVN 525

Query: 906  VKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQKNSDESISALPVDDLIEKADGFAGVF 1085
            VKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ N DES++ALPVDDLIEKADGFAGVF
Sbjct: 526  VKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ-NKDESVAALPVDDLIEKADGFAGVF 584

Query: 1086 P-----------------------------EHKYEIVKRLQARKHICGMTGDGVNDAPAL 1178
            P                             EHKYEIVKRLQARKHICGMTGDGVNDAPAL
Sbjct: 585  PGLYAINCRIKTKWLKVTKKNITVKFSLFSEHKYEIVKRLQARKHICGMTGDGVNDAPAL 644

Query: 1179 KKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRI 1358
            KKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRI
Sbjct: 645  KKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRI 704

Query: 1359 VLGFMLLALIWNFDFPPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLAEIFTTGVIL 1538
            V GFMLLALIW FDFPPFMVLIIAILNDGTIMTISKD VKPSPLPDSWKLAEIFTTGV+L
Sbjct: 705  VFGFMLLALIWEFDFPPFMVLIIAILNDGTIMTISKDLVKPSPLPDSWKLAEIFTTGVVL 764

Query: 1539 GGYLAIMTVIFFWAAYKTNFFPRLFHVESLEKTAQDDFQKLASAIYLQVSTISQALIFVT 1718
            GGYLA+MTVIFFWAAYKTNFFPR+FHVESLEKTAQDD+QKLASA+YLQVSTISQALIFVT
Sbjct: 765  GGYLAMMTVIFFWAAYKTNFFPRIFHVESLEKTAQDDYQKLASAVYLQVSTISQALIFVT 824

Query: 1719 RSRSWSFAERPGFLLVFAFFVAQLIATLIAVYADWKFAAIKGIGWGWAGVVWLYNIITYF 1898
            RSRSWSF ERPGFLLVFAFFVAQLIATLIAVYA+W F +IKGIGWGWAG+VWLYN++ YF
Sbjct: 825  RSRSWSFIERPGFLLVFAFFVAQLIATLIAVYANWAFTSIKGIGWGWAGIVWLYNLVFYF 884

Query: 1899 PLDIIKFLIRYTLSGKAWDLVIDQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPDAKM 2078
            PLDIIKFLIRY LSGKAWDLVI+QRIAFTRKKDFGKEERELKWAHA RTLHGLQPPDAK 
Sbjct: 885  PLDIIKFLIRYALSGKAWDLVIEQRIAFTRKKDFGKEERELKWAHAHRTLHGLQPPDAKP 944

Query: 2079 FSDKGGYNELNHMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV 2246
            F +K GY+ELN MAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDI+TI QSYTV
Sbjct: 945  FPEKTGYSELNQMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIHQSYTV 1000
 Score = 25.8 bits (55), Expect(2) = 0.0
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +1

Query: 1   GEIEAVVIATGV 36
           GEIEAVVIATGV
Sbjct: 214 GEIEAVVIATGV 225
  9635.m00896|protein  plasma-membrane proton-efflux P-type ATPase
            Length = 957
            
 Score = 1323 bits (3387), Expect(2) = 0.0
 Identities = 659/737 (89%), Positives = 696/737 (94%), Gaps = 1/737 (0%)
 Frame = +3

Query: 36   YTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVGMFIEIIVMYPIQHRAYRPGIDN 215
            +TFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIA+GM +EIIVMYPIQHR YRPGIDN
Sbjct: 221  HTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAIGMVVEIIVMYPIQHRDYRPGIDN 280

Query: 216  LLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTL 395
            LLVLLIGGIPIAMPTVLSVTMAIGSHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTL
Sbjct: 281  LLVLLIGGIPIAMPTVLSVTMAIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTL 340

Query: 396  NKLTVDKSLVEVFERGITQDQVILMAARASRTENQDAIDTAIVGMLADPKEARAGIQEVH 575
            NKLTVDKSL+EVF+RG+ QD VILMAARASRTENQDAID  IVGMLADPKEARAGIQEVH
Sbjct: 341  NKLTVDKSLIEVFQRGVDQDTVILMAARASRTENQDAIDATIVGMLADPKEARAGIQEVH 400

Query: 576  FLPFNPTDKRTALTYIDADGKMHRVSKGAPEQILHLAHNTSEIERRVHAVIDKFAERGLR 755
            FLPFNPTDKRTALTYID +GKMHRVSKGAPEQIL+LAHN +EIERRV AVIDKFAERGLR
Sbjct: 401  FLPFNPTDKRTALTYIDGEGKMHRVSKGAPEQILNLAHNKTEIERRVRAVIDKFAERGLR 460

Query: 756  SLAVAYQEVPDGRKESPGGPWHFAGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLA 935
            SL VAYQ+VPDGRKESPGGPW F GL+PLFDPPRHDSAETIRRALNLGVNVKMITGDQLA
Sbjct: 461  SLGVAYQQVPDGRKESPGGPWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLA 520

Query: 936  IGKETGRRLGMGTNMYPSSALLGQKNSDESISALPVDDLIEKADGFAGVFPEHKYEIVKR 1115
            IGKET RRLGMGTNMYPSSALLGQ + DESI ALPVD+LIEKADGFAGVFPEHKYEIVKR
Sbjct: 521  IGKETARRLGMGTNMYPSSALLGQ-DKDESIVALPVDELIEKADGFAGVFPEHKYEIVKR 579

Query: 1116 LQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTS 1295
            LQARKHICGMTGDGVNDAPALKKADIGIAV D+TDAARSASDIVLTEPGLSVIISAVLTS
Sbjct: 580  LQARKHICGMTGDGVNDAPALKKADIGIAVDDSTDAARSASDIVLTEPGLSVIISAVLTS 639

Query: 1296 RAIFQRMKNYTIYAVSITIRIVLGFMLLALIWNFDFPPFMVLIIAILNDGTIMTISKDRV 1475
            RAIFQRMKNYTIYAVSITIRIVLGFMLLALIW FDFPPFMVLIIAILNDGTIMTISKDRV
Sbjct: 640  RAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMVLIIAILNDGTIMTISKDRV 699

Query: 1476 KPSPLPDSWKLAEIFTTGVILGGYLAIMTVIFFWAAYKTNFFPRLFHVESLEKTAQDDFQ 1655
            KPSP PDSWKL+EIF TGV+LG YLA+MTVIFFW AYKT+FFPR+FHVESLEKTAQDDFQ
Sbjct: 700  KPSPQPDSWKLSEIFATGVVLGSYLAMMTVIFFWVAYKTDFFPRVFHVESLEKTAQDDFQ 759

Query: 1656 KLASAIYLQVSTISQALIFVTRSRSWSFAERPGFLLVFAFFVAQLIATLIAVYADWKFAA 1835
            KLASA+YLQVSTISQALIFVTRSRSWSF ERPGFLLVFAFFVAQLIATLIAVYA+W FA+
Sbjct: 760  KLASAVYLQVSTISQALIFVTRSRSWSFVERPGFLLVFAFFVAQLIATLIAVYANWGFAS 819

Query: 1836 IKGIGWGWAGVVWLYNIITYFPLDIIKFLIRYTLSGKAWDLVIDQRIAFTRKKDFGKEER 2015
            IKGIGWGWAGV+WLYNI+ Y PLDIIKFLIRY LSG+AWDLV++QRIAFTRKKDFG +E 
Sbjct: 820  IKGIGWGWAGVIWLYNIVFYLPLDIIKFLIRYALSGRAWDLVLEQRIAFTRKKDFGTQEN 879

Query: 2016 ELKWAHAQRTLHGLQP-PDAKMFSDKGGYNELNHMAEEAKRRAEIARLRELHTLKGHVES 2192
            +LKWA AQRT+HGLQP   A +F D   YN+LN +AEEA+RRAEIARLREL TLKG +ES
Sbjct: 880  QLKWATAQRTIHGLQPAATAAVFRDMTSYNDLNQLAEEARRRAEIARLRELTTLKGRMES 939

Query: 2193 VVKLKGLDIETIQQSYTV 2246
            VVK KGLD+ETIQQSYTV
Sbjct: 940  VVKQKGLDLETIQQSYTV 957
 Score = 25.8 bits (55), Expect(2) = 0.0
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +1

Query: 1   GEIEAVVIATGV 36
           GEIEAVVIATGV
Sbjct: 209 GEIEAVVIATGV 220
  9632.m05471|protein  plasma-membrane proton-efflux P-type ATPase
            Length = 951
            
 Score = 1206 bits (3086), Expect(2) = 0.0
 Identities = 599/737 (81%), Positives = 665/737 (89%), Gaps = 3/737 (0%)
 Frame = +3

Query: 36   YTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVGMFIEIIVMYPIQHRAYRPGIDN 215
            +TFFGKAAHLVDSTNQVGHFQ VLTAIGNFCICSIAVG+ IEIIVM+PIQHRAYR GI+N
Sbjct: 217  HTFFGKAAHLVDSTNQVGHFQTVLTAIGNFCICSIAVGIVIEIIVMFPIQHRAYRSGIEN 276

Query: 216  LLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTL 395
            LLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTL
Sbjct: 277  LLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTL 336

Query: 396  NKLTVDKSLVEVFERGITQDQVILMAARASRTENQDAIDTAIVGMLADPKEARAGIQEVH 575
            NKL+VDK+LVEVF +G+ +D V+L+AARASRTENQDAID A+VGMLADPKEARAGI+EVH
Sbjct: 337  NKLSVDKNLVEVFTKGVDKDHVLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVH 396

Query: 576  FLPFNPTDKRTALTYIDADGKMHRVSKGAPEQILHLAHNTSEIERRVHAVIDKFAERGLR 755
            FLPFNP DKRTALTYIDADG  HR SKGAPEQIL L +   +++R+VHAVIDK+AERGLR
Sbjct: 397  FLPFNPVDKRTALTYIDADGNWHRASKGAPEQILTLCNCKEDVKRKVHAVIDKYAERGLR 456

Query: 756  SLAVAYQEVPDGRKESPGGPWHFAGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLA 935
            SLAVA QEVP+  KES GGPW F GL+PLFDPPRHDSAETIR+AL+LGVNVKMITGDQLA
Sbjct: 457  SLAVARQEVPEKSKESAGGPWQFVGLLPLFDPPRHDSAETIRKALHLGVNVKMITGDQLA 516

Query: 936  IGKETGRRLGMGTNMYPSSALLGQKNSDESISALPVDDLIEKADGFAGVFPEHKYEIVKR 1115
            IGKETGRRLGMGTNMYPSSALLGQ N D S+ ALPVD+LIEKADGFAGVFPEHKYEIVKR
Sbjct: 517  IGKETGRRLGMGTNMYPSSALLGQ-NKDASLEALPVDELIEKADGFAGVFPEHKYEIVKR 575

Query: 1116 LQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTS 1295
            LQ +KHI GMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTS
Sbjct: 576  LQEKKHIVGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTS 635

Query: 1296 RAIFQRMKNYTIYAVSITIRIVLGFMLLALIWNFDFPPFMVLIIAILNDGTIMTISKDRV 1475
            R IFQRMKNYTIYAVSITIRIVLGF+L+ALIW +DF PFMVLIIAILNDGTIMTISKDRV
Sbjct: 636  RCIFQRMKNYTIYAVSITIRIVLGFLLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRV 695

Query: 1476 KPSPLPDSWKLAEIFTTGVILGGYLAIMTVIFFWAAYKTNFFPRLFHVESLEKTAQDDFQ 1655
            KPSPLPDSWKL EIF TG++LG YLA+MTVIFFWA +KT+FF   F V S+  +  +   
Sbjct: 696  KPSPLPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFTDKFGVRSIRNSEHE--- 752

Query: 1656 KLASAIYLQVSTISQALIFVTRSRSWSFAERPGFLLVFAFFVAQLIATLIAVYADWKFAA 1835
             + SA+YLQVS +SQALIFVTRSRSWSF ERPG LLV AF +AQL+AT +AVYA+W FA 
Sbjct: 753  -MMSALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVATFLAVYANWGFAR 811

Query: 1836 IKGIGWGWAGVVWLYNIITYFPLDIIKFLIRYTLSGKAWDLVIDQRIAFTRKKDFGKEER 2015
            IKGIGWGWAGV+WLY+I+ YFPLDI KF IR+ LSG+AWD +++ +IAFT KKD+G+EER
Sbjct: 812  IKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKIAFTTKKDYGREER 871

Query: 2016 ELKWAHAQRTLHGLQPPDA---KMFSDKGGYNELNHMAEEAKRRAEIARLRELHTLKGHV 2186
            E +WA AQRTLHGLQPP+     +F+DK  Y EL+ +AE+AKRRAEIARLREL+TLKGHV
Sbjct: 872  EAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHV 931

Query: 2187 ESVVKLKGLDIETIQQSYTV 2246
            ESVVKLKGLDI+TIQQ+YTV
Sbjct: 932  ESVVKLKGLDIDTIQQNYTV 951
 Score = 25.8 bits (55), Expect(2) = 0.0
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +1

Query: 1   GEIEAVVIATGV 36
           GEIEAVVIATGV
Sbjct: 205 GEIEAVVIATGV 216
  9631.m00012|protein  plasma-membrane proton-efflux P-type ATPase
            Length = 970
            
 Score = 1165 bits (2980), Expect(2) = 0.0
 Identities = 581/737 (78%), Positives = 649/737 (87%), Gaps = 10/737 (1%)
 Frame = +3

Query: 36   YTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVGMFIEIIVMYPIQHRAYRPGIDN 215
            +TFFGKAAHLV+ST  VGHFQKVLT+IGNFCICSIA GM IE++VMY +  R YR  +DN
Sbjct: 228  HTFFGKAAHLVESTTHVGHFQKVLTSIGNFCICSIAAGMVIELLVMYAVHERKYRQIVDN 287

Query: 216  LLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTL 395
            LLVLLIGGIPIAMPTVLSVTMAIGSH+L+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTL
Sbjct: 288  LLVLLIGGIPIAMPTVLSVTMAIGSHKLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTL 347

Query: 396  NKLTVDKSLVEVFERGITQDQVILMAARASRTENQDAIDTAIVGMLADPKEARAGIQEVH 575
            NKL+VDK+L+EVFE+GI +D V+LMAARASR ENQDAID AIV ML DPKEARAGIQEVH
Sbjct: 348  NKLSVDKNLIEVFEKGIEKDDVVLMAARASRLENQDAIDFAIVSMLPDPKEARAGIQEVH 407

Query: 576  FLPFNPTDKRTALTYIDADGKMHRVSKGAPEQILHLAHNTSEIERRVHAVIDKFAERGLR 755
            FLPFNPTDKRTALTY+DA+GKMHRVSKGAPEQIL+LA N  EIER+VH VI  FAERGLR
Sbjct: 408  FLPFNPTDKRTALTYLDAEGKMHRVSKGAPEQILNLASNKCEIERKVHHVIGNFAERGLR 467

Query: 756  SLAVAYQEVPDGRKESPGGPWHFAGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLA 935
            SLAVAYQEVP+G KESPGGPW F GL+PLFDPPRHDSAETIRRAL+LGV+VKMITGDQLA
Sbjct: 468  SLAVAYQEVPEGTKESPGGPWQFVGLLPLFDPPRHDSAETIRRALDLGVSVKMITGDQLA 527

Query: 936  IGKETGRRLGMGTNMYPSSALLGQKNSDESISALPVDDLIEKADGFAGVFPEHKYEIVKR 1115
            IGKETGRRLGMGTNMYPSS+LLG +  D  I+ LPVD+LIE+ADGFAGVFPEHKYEIV+R
Sbjct: 528  IGKETGRRLGMGTNMYPSSSLLGDR-KDGDIAVLPVDELIEQADGFAGVFPEHKYEIVQR 586

Query: 1116 LQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTS 1295
            LQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTS
Sbjct: 587  LQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTS 646

Query: 1296 RAIFQRMKNYTIYAVSITIRIVLGFMLLALIWNFDFPPFMVLIIAILNDGTIMTISKDRV 1475
            RAIFQRMKNYTIYAVSIT+RIVLGF+LLA  W FDFPPF+VL+IAILNDGTIMTISKD+V
Sbjct: 647  RAIFQRMKNYTIYAVSITVRIVLGFLLLACFWKFDFPPFLVLVIAILNDGTIMTISKDKV 706

Query: 1476 KPSPLPDSWKLAEIFTTGVILGGYLAIMTVIFFWAAYKTNFFPRLFHVESLEKTAQD--- 1646
            KPSP PDSWKL EIF TGVI+G YLA+ TV+FFWAAYKT FF  LF+V++L     D   
Sbjct: 707  KPSPYPDSWKLTEIFATGVIIGAYLAVTTVLFFWAAYKTQFFVHLFNVDTLNINKVDTTD 766

Query: 1647 ------DFQKLASAIYLQVSTISQALIFVTRSRSWSFAERPGFLLVFAFFVAQLIATLIA 1808
                  + +KLASA+YLQVSTISQALIFVTRSR WSF ERPG LL+ AF +AQLIAT++A
Sbjct: 767  NELVARNTEKLASAVYLQVSTISQALIFVTRSRGWSFLERPGLLLMAAFVIAQLIATVLA 826

Query: 1809 VYADWKFAAIKGIGWGWAGVVWLYNIITYFPLDIIKFLIRYTLSGKAWDLVIDQRIAFTR 1988
              A W+ A+I+GIGW WAG +W+YNI+ Y  LD +KF +RY LSGKAW+LVID ++AFT 
Sbjct: 827  AIATWEVASIRGIGWRWAGAIWVYNIVVYLLLDPMKFAVRYGLSGKAWNLVIDNKVAFTN 886

Query: 1989 KKDFGKEERELKWAHAQRTLHGLQPPDAKMFSDKGGYNELNHMAEEAKRRAEIARLRELH 2168
            +KDFG+E R + WAH QRTLHGLQ   ++   +K    ELN MAEEA+RRAEI RLRELH
Sbjct: 887  RKDFGREARVVAWAHEQRTLHGLQSAASR---EKAASTELNQMAEEARRRAEITRLRELH 943

Query: 2169 TLKGHVESVVKLKGLDIETI-QQSYTV 2246
            TLKG VESV KLKG+D+E +  Q YTV
Sbjct: 944  TLKGKVESVAKLKGIDLEDVNNQHYTV 970
 Score = 25.4 bits (54), Expect(2) = 0.0
 Identities = 11/12 (91%), Positives = 12/12 (99%)
 Frame = +1

Query: 1   GEIEAVVIATGV 36
           GEIEAVVIATG+
Sbjct: 216 GEIEAVVIATGI 227
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 160749966 Number of Sequences: 59712 Number of extensions: 4288822 Number of successful extensions: 15958 Number of sequences better than 1.0e-10: 53 Number of HSP's better than 0.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 12 Number of HSP's that attempted gapping in prelim test: 15827 Number of HSP's gapped (non-prelim): 79 length of query: 888 length of database: 26,991,925 effective HSP length: 54 effective length of query: 833 effective length of database: 23,767,477 effective search space: 19798308341 effective search space used: 19798308341 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 162 (67.5 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG410   Members:45             3pri:Y   1e-113      
P17784           Fructose-bisphosphate aldolase, cytoplasmic isozyme
pir||ADRZY fructose-bisphosphate aldolase (EC 4.1.2.13), c
         (1799 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9633.m03072|protein  Fructose-bisphosphate aldolase class-I     675  0.0
 9629.m06736|protein  Fructose-bisphosphate aldolase class-I     651  0.0
 9636.m00174|protein  Fructose-bisphosphate aldolase class-I     568  e-161
 9634.m03902|protein  Fructose-bisphosphate aldolase class-I     547  e-155
 9639.m00637|protein  Fructose-bisphosphate aldolase class-I     383  e-106
 9629.m00200|protein  Fructose-bisphosphate aldolase class-...   350  4e-96
 9639.m00638|protein  Fructose-bisphosphate aldolase class-I     336  8e-92
 9640.m00648|protein  Fructose-bisphosphate aldolase class-I     156  1e-37
 9637.m00098|protein  Similar to aldolase                        108  4e-23

  9633.m03072|protein  Fructose-bisphosphate aldolase class-I
            Length = 358
            
 Score =  675 bits (1722), Expect = 0.0
 Identities = 332/358 (92%), Positives = 344/358 (95%)
 Frame = +2

Query: 446  MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF 625
            MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVE+NRR+LRELLF
Sbjct: 1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLF 60

Query: 626  CTPGALQYLSGVILFEETLYQSTKGGKPFVDILKEGNVLPGIKVDKGTVELAGTNGETTT 805
            CTPGALQYLSGVILFEETLYQ TK GKPFVD+LKEG VLPGIKVDKGT+E+AGT  ETTT
Sbjct: 61   CTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTT 120

Query: 806  QGFDDLGKRCAKYYEAGARFAKWRAVLKIGPTEPSQLSINQNAQGLARYAIICQENGLVP 985
            QG DDLGKRCAKYYEAGARFAKWRAVLKIGP EPSQL+I+ NAQGLARYAIICQENGLVP
Sbjct: 121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP 180

Query: 986  IVEPEILVDGPHDIDRCAYVTEMVLAACYKALNDQHVLLEGTLLKPNMVTPGSDAKKVTP 1165
            IVEPEILVDGPHDIDRCAYV+E+VLAACYKALN+ HVLLEGTLLKPNMVTPGSDAKKV+P
Sbjct: 181  IVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAKKVSP 240

Query: 1166 EVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNKLQTKKPWNLSFSFGRAL 1345
            EVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNKL TKKPW+LSFSFGRAL
Sbjct: 241  EVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNKLSTKKPWSLSFSFGRAL 300

Query: 1346 QQSTLKAWSGKAENEEKARKAFLVRCKANSEATLGTYKGDATLGEGASESLHVKDYKY 1519
            QQSTLKAWSGKAEN EKAR AFL RCKANSEATLGTYKGDA LGEGASESLHVKDYKY
Sbjct: 301  QQSTLKAWSGKAENIEKARAAFLTRCKANSEATLGTYKGDAVLGEGASESLHVKDYKY 358
  9629.m06736|protein  Fructose-bisphosphate aldolase class-I
            Length = 358
            
 Score =  651 bits (1661), Expect = 0.0
 Identities = 320/358 (89%), Positives = 338/358 (94%)
 Frame = +2

Query: 446  MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF 625
            MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVE+NRR+LRELLF
Sbjct: 1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLF 60

Query: 626  CTPGALQYLSGVILFEETLYQSTKGGKPFVDILKEGNVLPGIKVDKGTVELAGTNGETTT 805
             TPGALQ+LSGVILFEETLYQ TK GKPFVD+LKEG VLPGIKVDKGTVE+AGTN ETTT
Sbjct: 61   TTPGALQHLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTVEVAGTNKETTT 120

Query: 806  QGFDDLGKRCAKYYEAGARFAKWRAVLKIGPTEPSQLSINQNAQGLARYAIICQENGLVP 985
            QG DDLGKRCAKYYEAGARFAKWRAVLKIGP EPSQLSI+ NAQGLARYAIICQENGLVP
Sbjct: 121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLSIDLNAQGLARYAIICQENGLVP 180

Query: 986  IVEPEILVDGPHDIDRCAYVTEMVLAACYKALNDQHVLLEGTLLKPNMVTPGSDAKKVTP 1165
            IVEPEILVDG HDI+RCAYVTE VLAACYKALN+ HVLLEG+LLKPNMVTPGS++KKV+P
Sbjct: 181  IVEPEILVDGSHDIERCAYVTEKVLAACYKALNEHHVLLEGSLLKPNMVTPGSESKKVSP 240

Query: 1166 EVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNKLQTKKPWNLSFSFGRAL 1345
            ++IAEYTVR LQRTVPAAVPAIVFLSGGQSEEEAT+NLNAMNKL TKKPW LSFSFGRAL
Sbjct: 241  QLIAEYTVRALQRTVPAAVPAIVFLSGGQSEEEATVNLNAMNKLSTKKPWALSFSFGRAL 300

Query: 1346 QQSTLKAWSGKAENEEKARKAFLVRCKANSEATLGTYKGDATLGEGASESLHVKDYKY 1519
            QQSTLKAW GK EN  KA+KAF+ RCKANSEATLGTY+GDA LGEGASESLHVKDYKY
Sbjct: 301  QQSTLKAWGGKTENVVKAQKAFITRCKANSEATLGTYQGDAVLGEGASESLHVKDYKY 358
  9636.m00174|protein  Fructose-bisphosphate aldolase class-I
            Length = 362
            
 Score =  568 bits (1447), Expect = e-161
 Identities = 286/358 (79%), Positives = 312/358 (86%), Gaps = 4/358 (1%)
 Frame = +2

Query: 446  MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF 625
            MSAYCGKYKDELI+NAAYIGTPGKGILAADESTGTIGKR ASI VENVE+NRRALRELLF
Sbjct: 1    MSAYCGKYKDELIRNAAYIGTPGKGILAADESTGTIGKRLASIGVENVEENRRALRELLF 60

Query: 626  CTPGALQYLSGVILFEETLYQSTKGGKPFVDILKEGNVLPGIKVDKGTVELAGTNGETTT 805
              PGAL  LSGVILFEETLYQST+ G PFVD+L    VL GIKVDKGTVELAGT+ ETTT
Sbjct: 61   TAPGALDCLSGVILFEETLYQSTRDGTPFVDVLAAAGVLAGIKVDKGTVELAGTDRETTT 120

Query: 806  QGFDDLGKRCAKYYEAGARFAKWRAVLKIG--PTEPSQLSINQNAQGLARYAIICQENGL 979
            QG D LG+RC +YY AGARFAKWRAVL IG   + PSQL+++ NAQGLARYAIICQENGL
Sbjct: 121  QGHDGLGERCRRYYAAGARFAKWRAVLSIGRASSRPSQLAVDANAQGLARYAIICQENGL 180

Query: 980  VPIVEPEILVDGPHDIDRCAYVTEMVLAACYKALNDQHVLLEGTLLKPNMVTPGSDAKKV 1159
            VPIVEPEILVDG H I+ CA VTE VLAACYKAL+D HVLLEGTLLKPNMVTPGSDA + 
Sbjct: 181  VPIVEPEILVDGEHGIEACAEVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDAARA 240

Query: 1160 TPEVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNKLQT--KKPWNLSFSF 1333
             PEV+AE+TVR L RTVP AVPAIVFLSGGQSEEEAT NLNAMN++ +  KKPW+L+FSF
Sbjct: 241  PPEVVAEHTVRALLRTVPPAVPAIVFLSGGQSEEEATRNLNAMNQVASRGKKPWSLTFSF 300

Query: 1334 GRALQQSTLKAWSGKAENEEKARKAFLVRCKANSEATLGTYKGDATLGEGASESLHVKDY 1513
            GRALQQSTLKAW+GKAEN  KA+ A L RC+ANS+ATLG Y GDA  GEG SE+LHVKDY
Sbjct: 301  GRALQQSTLKAWAGKAENVGKAQAALLARCRANSQATLGAYAGDAAAGEGVSENLHVKDY 360

Query: 1514 KY 1519
            KY
Sbjct: 361  KY 362
  9634.m03902|protein  Fructose-bisphosphate aldolase class-I
            Length = 358
            
 Score =  547 bits (1393), Expect = e-155
 Identities = 280/358 (78%), Positives = 301/358 (83%), Gaps = 2/358 (0%)
 Frame = +2

Query: 446  MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF 625
            MSA+ GKY DELIK A YI TPGKGILAADESTGTIGKR ASINVENVE NR+ALRELLF
Sbjct: 1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLASINVENVEPNRQALRELLF 60

Query: 626  CTPGALQYLSGVILFEETLYQSTKGGKPFVDILKEGNVLPGIKVDKGTVELAGTNGETTT 805
             TPGA QYLSGVILFEETLYQST  G PFVD+LK G V+PGIKVDKGTV++AGTNGETTT
Sbjct: 61   TTPGAFQYLSGVILFEETLYQSTAAGTPFVDVLKAGGVVPGIKVDKGTVDIAGTNGETTT 120

Query: 806  QGFDDLGKRCAKYYEAGARFAKWRAVLKIGPT-EPSQLSINQNAQGLARYAIICQENGLV 982
            QG D LG RCAKYYEAGARFAKWRAVLKIG   EPS+L++ QNA+GLARYA+ICQENGLV
Sbjct: 121  QGLDSLGARCAKYYEAGARFAKWRAVLKIGAAGEPSELAVKQNAEGLARYALICQENGLV 180

Query: 983  PIVEPEILVDGPHDIDRCAYVTEMVLAACYKALNDQHVLLEGTLLKPNMVTPGSDAKKVT 1162
            PIVEPEIL DG HDI  CA VTE VLAA YK+LND  VLLEGTLLKPNMVTPGSD+ KV 
Sbjct: 181  PIVEPEILTDGAHDIKTCAAVTERVLAAVYKSLNDHKVLLEGTLLKPNMVTPGSDSPKVG 240

Query: 1163 PEVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNKLQTKKPWNLSFSFGRA 1342
             EVI EYTV  L+RTVP AVP IVFLSGGQSEEEA+ NLNAMNKL+  KPW L+FSFGRA
Sbjct: 241  AEVIGEYTVAALRRTVPPAVPGIVFLSGGQSEEEASQNLNAMNKLEVLKPWTLTFSFGRA 300

Query: 1343 LQQSTLKAWSGKAENEEKARKAFLVRCKANSEATLGTYKGDATLGEGA-SESLHVKDYKY 1519
            LQQST+K W GK EN   A+ AFL RCKANSEATLG Y G A  G+ A SESL+VK Y Y
Sbjct: 301  LQQSTIKKWGGKKENVAAAQAAFLARCKANSEATLGKYGGAA--GDAATSESLYVKGYTY 358
  9639.m00637|protein  Fructose-bisphosphate aldolase class-I
            Length = 388
            
 Score =  383 bits (972), Expect = e-106
 Identities = 203/363 (55%), Positives = 249/363 (67%), Gaps = 1/363 (0%)
 Frame = +2

Query: 431  PRASTMSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRAL 610
            P   +M    G Y DEL+K A  I +PG+GILA DES  T GKR ASI +EN E NR+A 
Sbjct: 29   PVTVSMVVRAGAYDDELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAY 88

Query: 611  RELLFCTPGALQYLSGVILFEETLYQSTKGGKPFVDILKEGNVLPGIKVDKGTVELAGTN 790
            R LL   PG  QY+SG ILFEETLYQST  GK  VDIL E  ++PGIKVDKG V LAG+N
Sbjct: 89   RTLLVTAPGLGQYISGAILFEETLYQSTVDGKKIVDILTEQKIVPGIKVDKGLVPLAGSN 148

Query: 791  GETTTQGFDDLGKRCAKYYEAGARFAKWRAVLKIGPTEPSQLSINQNAQGLARYAIICQE 970
             E+  QG D L  R A YY+ GARFAKWR V+ I P  PS+L++ + A GLARYA I Q+
Sbjct: 149  NESWCQGLDGLASREAAYYQQGARFAKWRTVVSI-PNGPSELAVKEAAWGLARYAAISQD 207

Query: 971  NGLVPIVEPEILVDGPHDIDRCAYVTEMVLAACYKALNDQHVLLEGTLLKPNMVTPGSDA 1150
            NGLVPIVEPEIL+DG H IDR   V + V A  +  + + +V+ EG LLKP+MVTPG++ 
Sbjct: 208  NGLVPIVEPEILLDGEHGIDRTFEVAQKVWAETFFYMAENNVMFEGILLKPSMVTPGAEC 267

Query: 1151 K-KVTPEVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNKLQTKKPWNLSF 1327
            K + TPE +++YT++ L R +P AVP I+FLSGGQSE EAT NLNAMN  Q   PW++SF
Sbjct: 268  KDRATPEQVSDYTLKLLHRRIPPAVPGIMFLSGGQSEVEATQNLNAMN--QGPNPWHVSF 325

Query: 1328 SFGRALQQSTLKAWSGKAENEEKARKAFLVRCKANSEATLGTYKGDATLGEGASESLHVK 1507
            S+ RALQ + LK W G+ EN + A+ A L+R KANS A LG Y  D    E A E + VK
Sbjct: 326  SYARALQNTCLKTWGGQPENVKAAQDALLLRAKANSLAQLGKYTSDGEAAE-AKEGMFVK 384

Query: 1508 DYKY 1519
            +Y Y
Sbjct: 385  NYVY 388
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 122490674 Number of Sequences: 59712 Number of extensions: 3935197 Number of successful extensions: 35962 Number of sequences better than 1.0e-10: 18 Number of HSP's better than 0.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 35935 Number of HSP's gapped (non-prelim): 12 length of query: 599 length of database: 26,991,925 effective HSP length: 53 effective length of query: 546 effective length of database: 23,827,189 effective search space: 13009645194 effective search space used: 13009645194 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 161 (67.1 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG413   Members:57             3pri:Y   1e-123      
BAB86847.1       elongation factor EF-2 [Pisum sativum]
         (2889 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9630.m03028|protein  AF367331 At1g56070/T6H22_13               1631  0.0
 9632.m00189|protein  Elongation factor G, domain IV, putative  1624  0.0
 9629.m05250|protein  Elongation factor G, domain IV, putative  1523  0.0
 9629.m05092|protein  Elongation factor G, domain IV, putative  1372  0.0
 9634.m03897|protein  Elongation factor G, domain IV, putative   618  e-176
 9630.m03217|protein  Similar to elongation factor EF-2          330  6e-90
 9631.m04330|protein  putative translation elongation factor     309  1e-83
 9631.m03522|protein  translation elongation factor G            137  9e-32
 9634.m00447|protein  Similar to GTP-binding membrane prote...   107  1e-22
 9630.m00559|protein  Similar to GTP-binding protein LepA h...   106  3e-22
 9630.m01743|protein  Elongation factor Tu GTP binding doma...   105  4e-22
 9632.m04375|protein  translation elongation factor G            104  8e-22
 9629.m05356|protein  Elongation factor Tu GTP binding doma...    97  1e-19

  9630.m03028|protein  AF367331 At1g56070/T6H22_13
            Length = 843
            
 Score = 1631 bits (4178), Expect = 0.0
 Identities = 797/843 (94%), Positives = 823/843 (97%)
 Frame = +1

Query: 133  MVKFTAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 312
            MVKFT EELR IMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR
Sbjct: 1    MVKFTVEELRRIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 60

Query: 313  ADEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALR 492
            ADEAERGITIKSTGISLFY+M+ ESL++YKG+RDG+EYLINLIDSPGHVDFSSEVTAALR
Sbjct: 61   ADEAERGITIKSTGISLFYEMSDESLKLYKGERDGNEYLINLIDSPGHVDFSSEVTAALR 120

Query: 493  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQFEGEEAYQTFSR 672
            ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQ EGEEAYQTFSR
Sbjct: 121  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR 180

Query: 673  VIENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDEVKM 852
            VIENANVIMATYED LLGDVQVYPEKGTVAFSAGLHGWAFTL++FAKMYASKFGVDE KM
Sbjct: 181  VIENANVIMATYEDTLLGDVQVYPEKGTVAFSAGLHGWAFTLSSFAKMYASKFGVDEFKM 240

Query: 853  MERLWGENFFDPATKKWTSKNTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPMLKK 1032
            MERLWGENFFDPATKKWT+KNTG+ATCKRGFVQFCYEPIKQII TCMNDQKDKLWPML+K
Sbjct: 241  MERLWGENFFDPATKKWTNKNTGSATCKRGFVQFCYEPIKQIINTCMNDQKDKLWPMLQK 300

Query: 1033 LGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGPLD 1212
            LGV MK DEK+LMGKALMKRVMQTWLPAS ALLEMMI+HLPSPSKAQRYRVENLYEGPLD
Sbjct: 301  LGVVMKADEKELMGKALMKRVMQTWLPASNALLEMMIYHLPSPSKAQRYRVENLYEGPLD 360

Query: 1213 DIYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVPGQ 1392
            D+YA AIRNCDP+GPLMLYVSKMIPASDKGRFFAFGRVF+GRVATGMKVRIMGPN+VPGQ
Sbjct: 361  DVYATAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGRVATGMKVRIMGPNYVPGQ 420

Query: 1393 KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEKEVDACPIRA 1572
            KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVA+VGLDQFITKNATLTNEKE DACPIRA
Sbjct: 421  KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVAMVGLDQFITKNATLTNEKESDACPIRA 480

Query: 1573 MKFSVSPVVRVAVQCKTASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI 1752
            MKFSVSPVVRVAVQCK ASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI
Sbjct: 481  MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI 540

Query: 1753 CLKDLQDDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 1932
            CLKDLQ+DFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE
Sbjct: 541  CLKDLQEDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 600

Query: 1933 AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 2112
            AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI
Sbjct: 601  AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 660

Query: 2113 KDSVVAGFQWASKEGALCEENMRGICYEVCDVVLHTDAIHRGGGQVIPTARRVIYASQLT 2292
            KDSVVAGFQWASKEGAL EENMRGIC+EVCDVVLH DAIHRGGGQVIPTARRVIYASQLT
Sbjct: 661  KDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLT 720

Query: 2293 AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRQGTPLYNIKAYLPVIESFG 2472
            AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQR GTPLYNIKAYLPVIESFG
Sbjct: 721  AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFG 780

Query: 2473 FSSTLRAATSGQAFPQCVFDHWDIMASDPLDPGTQSATLVTEIRKRKGLKEQMTPLSDFE 2652
            FSS LRAATSGQAFPQCVFDHWD+M SDPL+ G+Q++TLV +IRKRKGLKEQMTPLSDFE
Sbjct: 781  FSSQLRAATSGQAFPQCVFDHWDMMTSDPLEAGSQASTLVQDIRKRKGLKEQMTPLSDFE 840

Query: 2653 DKL 2661
            DKL
Sbjct: 841  DKL 843
  9632.m00189|protein  Elongation factor G, domain IV, putative
            Length = 843
            
 Score = 1624 bits (4159), Expect = 0.0
 Identities = 794/843 (94%), Positives = 820/843 (97%)
 Frame = +1

Query: 133  MVKFTAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 312
            MVKFT EELR IMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR
Sbjct: 1    MVKFTVEELRRIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 60

Query: 313  ADEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALR 492
            ADEAERGITIKSTGISLFY+M+ ESL++YKG+RDG+EYLINLIDSPGHVDFSSEVTAALR
Sbjct: 61   ADEAERGITIKSTGISLFYEMSDESLKLYKGERDGNEYLINLIDSPGHVDFSSEVTAALR 120

Query: 493  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQFEGEEAYQTFSR 672
            ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQ EGEEAYQTFSR
Sbjct: 121  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR 180

Query: 673  VIENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDEVKM 852
            VIENANVIMATYED LLGDVQVYPEKGTVAFSAGLHGWAFTL++FAKMYASKFGVDE KM
Sbjct: 181  VIENANVIMATYEDTLLGDVQVYPEKGTVAFSAGLHGWAFTLSSFAKMYASKFGVDESKM 240

Query: 853  MERLWGENFFDPATKKWTSKNTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPMLKK 1032
            MERLWGENFFDPATKKWT+K+TG+ATCKRGFVQFCYEPIKQII TCMNDQKDKLWPML+K
Sbjct: 241  MERLWGENFFDPATKKWTNKSTGSATCKRGFVQFCYEPIKQIINTCMNDQKDKLWPMLQK 300

Query: 1033 LGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGPLD 1212
            LGV MK DEKDLMGKALMKRVMQTWLPAS ALLEMMI+HLPSPSKAQ+YRVENLYEGPLD
Sbjct: 301  LGVVMKADEKDLMGKALMKRVMQTWLPASNALLEMMIYHLPSPSKAQKYRVENLYEGPLD 360

Query: 1213 DIYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVPGQ 1392
            D+YA AIRNCDP+GPLMLYVSKMIPASDKGRFFAFGRVF+GRVATGMKVRIMGPN+VPGQ
Sbjct: 361  DVYATAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGRVATGMKVRIMGPNYVPGQ 420

Query: 1393 KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEKEVDACPIRA 1572
            KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVA+VGLDQFITKNATLTNEKE DACPIRA
Sbjct: 421  KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVAMVGLDQFITKNATLTNEKEADACPIRA 480

Query: 1573 MKFSVSPVVRVAVQCKTASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI 1752
            MKFSVSPVVRVAVQCK ASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI
Sbjct: 481  MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI 540

Query: 1753 CLKDLQDDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 1932
            CLKDLQ+DFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE
Sbjct: 541  CLKDLQEDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 600

Query: 1933 AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 2112
            AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI
Sbjct: 601  AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 660

Query: 2113 KDSVVAGFQWASKEGALCEENMRGICYEVCDVVLHTDAIHRGGGQVIPTARRVIYASQLT 2292
            KDSVVAGFQWASKEGAL EENMRGIC+EVCDVVLH DAIHRGGGQVIPTARRVIYASQLT
Sbjct: 661  KDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLT 720

Query: 2293 AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRQGTPLYNIKAYLPVIESFG 2472
            AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQR GTPLYNIKAYLPVIESFG
Sbjct: 721  AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFG 780

Query: 2473 FSSTLRAATSGQAFPQCVFDHWDIMASDPLDPGTQSATLVTEIRKRKGLKEQMTPLSDFE 2652
            FSS LRAATSGQAFPQCVFDHWD+M SDPL+  +Q+  LV +IRKRKGLKEQMTPLSDFE
Sbjct: 781  FSSQLRAATSGQAFPQCVFDHWDMMTSDPLEVSSQANQLVLDIRKRKGLKEQMTPLSDFE 840

Query: 2653 DKL 2661
            DKL
Sbjct: 841  DKL 843
  9629.m05250|protein  Elongation factor G, domain IV, putative
            Length = 826
            
 Score = 1523 bits (3899), Expect = 0.0
 Identities = 742/819 (90%), Positives = 787/819 (95%), Gaps = 2/819 (0%)
 Frame = +1

Query: 133  MVKFTAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 312
            MVKFT EE+R IMDKK+NIRNMSV+AHVDHGKSTLTDSLVAAAGIIAQ+VAGDVRMTD+R
Sbjct: 1    MVKFTVEEMRRIMDKKHNIRNMSVVAHVDHGKSTLTDSLVAAAGIIAQDVAGDVRMTDSR 60

Query: 313  ADEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALR 492
            +DEAERGITIKSTGISL+Y+M+ ESL+ YKGDRDG+EYLINLIDSPGHVDFSSEVTAALR
Sbjct: 61   SDEAERGITIKSTGISLYYEMSDESLKSYKGDRDGNEYLINLIDSPGHVDFSSEVTAALR 120

Query: 493  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQFEGEEAYQTFSR 672
            ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQ  GEEAYQTFSR
Sbjct: 121  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVGGEEAYQTFSR 180

Query: 673  VIENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDEVKM 852
            VIENANVIMATYED LLGDVQVYPEKGTVAFSAGLHGWAFTL+NFAKMYASKFGVDE KM
Sbjct: 181  VIENANVIMATYEDALLGDVQVYPEKGTVAFSAGLHGWAFTLSNFAKMYASKFGVDESKM 240

Query: 853  MERLWGENFFDPATKKWTSKNTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPMLKK 1032
            MERLWGEN+FDP TKKWT K+TG+ TCKRGF+QFCYEPI+QII TCMNDQKDKL PML+K
Sbjct: 241  MERLWGENYFDPTTKKWTIKHTGSDTCKRGFIQFCYEPIRQIINTCMNDQKDKLLPMLQK 300

Query: 1033 LGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGPLD 1212
            LGVTMK    DL GKALMKRVMQTWLPAS ALLEMMI+HLPSP+KAQRYRVENLYEGPLD
Sbjct: 301  LGVTMK----DLTGKALMKRVMQTWLPASNALLEMMIYHLPSPAKAQRYRVENLYEGPLD 356

Query: 1213 DIYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVPGQ 1392
            DIYA+AIRNCDP+GPLMLYVSKMIPASDKGRF+AFGRVF+GRVATGMKVRIMGPN+ PGQ
Sbjct: 357  DIYASAIRNCDPEGPLMLYVSKMIPASDKGRFYAFGRVFSGRVATGMKVRIMGPNYAPGQ 416

Query: 1393 KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEKEVDACPIRA 1572
            KKDLYVK+VQRTVIWMGKKQESVE VPCGNTVA+VGLDQFITKNATLTNEKEVDACPI+A
Sbjct: 417  KKDLYVKNVQRTVIWMGKKQESVEGVPCGNTVAMVGLDQFITKNATLTNEKEVDACPIKA 476

Query: 1573 MKFSVSPVVRVAVQCKTASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI 1752
            MKFSVSPVVRVAVQCK ASDLPKLVEGLKRLAKSDPMVLCT+EESGEHIIAGAGELHLEI
Sbjct: 477  MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTVEESGEHIIAGAGELHLEI 536

Query: 1753 CLKDLQDDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 1932
            CLKDLQ+DFMGGAEI VSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARP+EEGL E
Sbjct: 537  CLKDLQEDFMGGAEITVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPMEEGLPE 596

Query: 1933 AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 2112
            AID+GRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPN+VVDMCKGVQYLNEI
Sbjct: 597  AIDEGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNIVVDMCKGVQYLNEI 656

Query: 2113 KDSVVAGFQWASKEGALCEENM--RGICYEVCDVVLHTDAIHRGGGQVIPTARRVIYASQ 2286
            KDSVVAGFQWASKEGAL EENM  RGIC+EVCDV+LH+DAIHRGGGQ+IPTARRVIYA+Q
Sbjct: 657  KDSVVAGFQWASKEGALAEENMRGRGICFEVCDVILHSDAIHRGGGQIIPTARRVIYAAQ 716

Query: 2287 LTAKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRQGTPLYNIKAYLPVIES 2466
            LTAKPRLLEPVYLVEIQAPENALGGIY VLNQKRGHVFEEMQR GTPLYNIKAYLPVIES
Sbjct: 717  LTAKPRLLEPVYLVEIQAPENALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIES 776

Query: 2467 FGFSSTLRAATSGQAFPQCVFDHWDIMASDPLDPGTQSATL 2589
            FGF+STLRAATSGQAFP  VFDHW++++ DPL+PGT+  TL
Sbjct: 777  FGFTSTLRAATSGQAFPLFVFDHWEMLSVDPLEPGTRQLTL 817
  9629.m05092|protein  Elongation factor G, domain IV, putative
            Length = 853
            
 Score = 1372 bits (3511), Expect = 0.0
 Identities = 659/843 (78%), Positives = 750/843 (88%), Gaps = 10/843 (1%)
 Frame = +1

Query: 133  MVKFTAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 312
            MV+FTAEELR  MDKK+NIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQ+VAGDVRMTDTR
Sbjct: 1    MVRFTAEELRASMDKKDNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQDVAGDVRMTDTR 60

Query: 313  ADEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALR 492
            ADEAERGITIKSTGISL+Y+MT  +L  ++G RDG+ YLINLIDSPGH+DFSSEVTAALR
Sbjct: 61   ADEAERGITIKSTGISLYYEMTDAALRSFEGKRDGNSYLINLIDSPGHIDFSSEVTAALR 120

Query: 493  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQFEGEEAYQTFSR 672
            ITDGALVVVDCIEGVCVQTETVLRQ+L ERI+PVLTVNKMDRCFLELQ  GEEAYQ FSR
Sbjct: 121  ITDGALVVVDCIEGVCVQTETVLRQSLAERIKPVLTVNKMDRCFLELQQSGEEAYQAFSR 180

Query: 673  VIENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDEVKM 852
            VIE+ NV MA YED  LGD  V PEKGTVAFSAGLHGWAFTL+NFAKMY +KF VDE KM
Sbjct: 181  VIESVNVTMAPYEDKNLGDCMVAPEKGTVAFSAGLHGWAFTLSNFAKMYKAKFKVDEAKM 240

Query: 853  MERLWGENFFDPATKKWTSK--NTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPML 1026
            MERLWGEN+FD  TKKWT+   +T + TC+RGFVQFCYEPI++II+ CMND K+ LW ML
Sbjct: 241  MERLWGENYFDHTTKKWTTTAPSTSSKTCQRGFVQFCYEPIRRIISACMNDDKENLWDML 300

Query: 1027 KKLGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGP 1206
             KL +T+K +EK+L GK LMKRVMQ WLPAS ALLEM++FHLPSP+KAQ+YRV+ LY+GP
Sbjct: 301  TKLKITLKAEEKELTGKKLMKRVMQAWLPASDALLEMIVFHLPSPAKAQQYRVDTLYDGP 360

Query: 1207 LDDIYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVP 1386
            LDD YA AIRNCDP GPLM+YVSKMIPASDKGRFFAFGRVF+G VATG KVRIMGPNFVP
Sbjct: 361  LDDPYATAIRNCDPKGPLMVYVSKMIPASDKGRFFAFGRVFSGTVATGNKVRIMGPNFVP 420

Query: 1387 GQKKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEKEVDACPI 1566
            G+KKDLYVK+VQRTVIWMGKKQESV+DVPCGNTVA+VGLDQFITKNATLT+EK VDA PI
Sbjct: 421  GEKKDLYVKTVQRTVIWMGKKQESVDDVPCGNTVAMVGLDQFITKNATLTDEKAVDAHPI 480

Query: 1567 RAMKFSVSPVVRVAVQCKTASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHL 1746
            +AMKFSVSPVVR +V CK AS+LPKLVEGLKRLAKSDP+V+CTIEESGEH+IAG G+LHL
Sbjct: 481  KAMKFSVSPVVRKSVACKNASELPKLVEGLKRLAKSDPLVVCTIEESGEHVIAGVGQLHL 540

Query: 1747 EICLKDLQDDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPL---- 1914
            EIC+KDLQ+DFMGGAEIIV PP++++RETV + SCRTVMSKSPNKHNRLYMEARPL    
Sbjct: 541  EICIKDLQEDFMGGAEIIVGPPIITYRETVTKNSCRTVMSKSPNKHNRLYMEARPLDKED 600

Query: 1915 ----EEGLAEAIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDM 2082
                E  L +AIDD RIGP+DD K R KILSEEFGWDKDLAKKIW FGPET GPN++VDM
Sbjct: 601  LQQDEPSLCKAIDDERIGPKDDIKERGKILSEEFGWDKDLAKKIWAFGPETKGPNLLVDM 660

Query: 2083 CKGVQYLNEIKDSVVAGFQWASKEGALCEENMRGICYEVCDVVLHTDAIHRGGGQVIPTA 2262
            CKGVQYL+EIKDSVVAGFQWASKEGAL EENMRG+C+E+CDV LH+D+IHRGGGQ+IPTA
Sbjct: 661  CKGVQYLSEIKDSVVAGFQWASKEGALAEENMRGVCFELCDVTLHSDSIHRGGGQLIPTA 720

Query: 2263 RRVIYASQLTAKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRQGTPLYNIK 2442
            RR +YA+QLTA PRL+EP+Y V+IQ P+ A+G +YGVLN + G + EE +R GTPL N++
Sbjct: 721  RRAMYAAQLTASPRLMEPMYQVDIQVPKTAVGNVYGVLNSRNGELVEESERTGTPLSNLR 780

Query: 2443 AYLPVIESFGFSSTLRAATSGQAFPQCVFDHWDIMASDPLDPGTQSATLVTEIRKRKGLK 2622
             YLPV +SF F+  LRA TSGQAFPQC+F HW  M SDP   G+++A ++T+IRKRKGLK
Sbjct: 781  FYLPVAKSFDFTEKLRAETSGQAFPQCIFHHWQTMRSDPFQEGSEAAKVITDIRKRKGLK 840

Query: 2623 EQMTPLSDFEDKL 2661
            + +TPLSD+EDKL
Sbjct: 841  DIITPLSDYEDKL 853
  9634.m03897|protein  Elongation factor G, domain IV, putative
            Length = 997
            
 Score =  618 bits (1577), Expect = e-176
 Identities = 327/839 (38%), Positives = 507/839 (59%), Gaps = 22/839 (2%)
 Frame = +1

Query: 145  TAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIA---QEVAGDVRMTDTRA 315
            T + L G+      +RN++++ H+ HGK+   D LV     +     E    VR TDTR 
Sbjct: 134  TTDFLLGLAANPALVRNVALVGHLQHGKTVFMDMLVEQTHEVDTFDSEGERHVRFTDTRV 193

Query: 316  DEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALRI 495
            DE ER ++IK+  +SL  +             +G  YL N++D+PGHV+FS E+TAALRI
Sbjct: 194  DEQERRVSIKAVPMSLVLE-----------GGNGKSYLCNIMDTPGHVNFSDEMTAALRI 242

Query: 496  TDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQFEGEEAYQTFSRV 675
             DGA++VVD  EGV V TE  +R A  ER+  V+ +NK+DR   EL+    +AY      
Sbjct: 243  ADGAVLVVDAAEGVMVNTERAIRHATQERLPIVVVINKVDRLITELKLPPNDAYFKLRHT 302

Query: 676  IENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGV--DEVK 849
            +E  N ++++    + G   V P  G V F++G  GW+FTL +FA +Y    G+  D  K
Sbjct: 303  LEAINDLISSCSTTVGGTQLVDPAAGNVCFASGSAGWSFTLQSFAHLYLKIHGIQFDHEK 362

Query: 850  MMERLWGENFFDPATKKWTSKNTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPMLK 1029
               RLWG+ ++ P T+ +  K        R FV+F  EP+ +I +  + + K K+   L 
Sbjct: 363  FASRLWGDLYYHPDTRTFKKKPPKEGA-NRSFVEFVLEPLYKIYSQVVGESKGKVEATLS 421

Query: 1030 KLGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGPL 1209
            +LGVT+ N    L  + L++   ++    S    +M++ H+PS   A   ++E++Y GP 
Sbjct: 422  ELGVTLSNAAYKLNVRPLLRLACRSIFGTSTGFTDMLVKHIPSVKDAAPRKIEHIYTGPQ 481

Query: 1210 DDIYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVPG 1389
            D    +A++ CDP  PLM+ V+K+ P SD   F AFGRV++G + TG  VR++G  + P 
Sbjct: 482  DSTIVDAMKKCDPHAPLMVNVTKLYPKSDCSVFDAFGRVYSGTIQTGQTVRVLGEGYSPD 541

Query: 1390 QKKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEK-EVDACPI 1566
             ++D+ VK V +  ++  + +  +   P G+ V + G+D  I K AT+   K + D    
Sbjct: 542  DEEDMTVKEVTKLWVYQARYRVPISKAPAGSWVLIEGVDASIMKTATICPMKMDEDVYIF 601

Query: 1567 RAMKFSVSPVVRVAVQCKTASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHL 1746
            R ++F+  PVV++A +    S+LPK+VEGL++++KS P+ +  +EESGEH I G GEL+L
Sbjct: 602  RPLRFNTLPVVKIAAEPLNPSELPKMVEGLRKISKSYPLAVTKVEESGEHTILGTGELYL 661

Query: 1747 EICLKDLQDDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGL 1926
            +  +KDL++ +    E+ V+ PVV+F ETV++ S     +++PNK N++ M A PLE+GL
Sbjct: 662  DSIMKDLRELY-SEVEVKVADPVVTFCETVVDTSSMKCFAETPNKRNKITMVAEPLEKGL 720

Query: 1927 AEAIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQY-- 2100
            AE I++G +      K  +    + + WD   A+ IW FGPE  GPN+++D    V+   
Sbjct: 721  AEDIENGLVSLDSRQKEITDFFRQRYQWDVLAARSIWAFGPEKQGPNILLDDTLSVEVDK 780

Query: 2101 --LNEIKDSVVAGFQWASKEGALCEENMRGICYEVCDVVLHTDAIHRGGGQVIPTARRVI 2274
              LN +KDS+V GFQW ++EG LC+E +R + +++ +  +  + +HRGGGQ+IPTARRV+
Sbjct: 781  NLLNAVKDSIVQGFQWGAREGPLCDEPIRNVKFKILNANIAPEPLHRGGGQIIPTARRVV 840

Query: 2275 YASQLTAKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRQGTPLYNIKAYLP 2454
            Y++ L A PRL+EPVY +EIQ P + +  IY VL+++RGHV  ++ + GTP+Y +KA+LP
Sbjct: 841  YSAFLMANPRLMEPVYYIEIQTPIDCVSAIYTVLSRRRGHVTADVPKPGTPIYVVKAFLP 900

Query: 2455 VIESFGFSSTLRAATSGQAFPQCVFDHWDIMASDPLDPGTQSATL------------VTE 2598
            VIESFGF + LR  T GQAF   VFDHW I+  DPLD       L            + +
Sbjct: 901  VIESFGFETDLRYHTQGQAFCLSVFDHWAIVPGDPLDKNIVLRPLEPAPIQHLAREFMVK 960

Query: 2599 IRKRKGLKEQMTPLSDFEDKL 2661
             R+RKG+ E ++    F++ +
Sbjct: 961  TRRRKGMSEDVSINKFFDEAM 981
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 181160810 Number of Sequences: 59712 Number of extensions: 4977739 Number of successful extensions: 16715 Number of sequences better than 1.0e-10: 26 Number of HSP's better than 0.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 16658 Number of HSP's gapped (non-prelim): 32 length of query: 963 length of database: 26,991,925 effective HSP length: 54 effective length of query: 908 effective length of database: 23,767,477 effective search space: 21580869116 effective search space used: 21580869116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 163 (67.9 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG422   Members:65             3pri:Y   1e-132      
AAB18209.1       chlorophyll a/b-binding protein WCAB precursor
[Triticum aestivum]
         (1226 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9629.m03990|protein  Chlorophyll A-B binding protein, puta...   499  e-141
 9629.m05067|protein  Chlorophyll A-B binding protein, puta...   499  e-141
 9637.m01516|protein  chlorophyll a/b-binding protein I pre...   495  e-140
 9631.m03807|protein  chlorophyll a/b binding protein            414  e-115
 9635.m03724|protein  chlorophyll a-b binding protein of lh...   343  3e-94
 9637.m00977|protein  Chlorophyll A-B binding protein, puta...   219  6e-57
 9639.m01284|protein  chlorophyll a/b-binding protein CP26 ...   215  2e-55
 9634.m02114|protein  chlorophyll a/b-binding protein precu...   140  4e-33
 9635.m03882|protein  LHCI-680, photosystem I antenna prote...   136  6e-32
 9630.m05194|protein  light-harvesting complex protein [imp...   128  2e-29
 9630.m00958|protein  chlorophyll a/b-binding protein type ...   127  5e-29
 9637.m02343|protein  AY086461 PSI type II chlorophyll a/b-...   122  1e-27
 9639.m01283|protein  chlorophyll a/b-binding protein CP26 ...   118  3e-26
 9635.m03689|protein  probable chlorophyll a/b-binding prot...   116  8e-26
 9630.m00957|protein  chlorophyll a/b-binding protein type ...    82  2e-16
 9632.m03624|protein  chlorophyll a/b-binding apoprotein CP...    81  5e-15

  9629.m03990|protein  Chlorophyll A-B binding protein, putative
           Length = 261
           
 Score =  499 bits (1271), Expect = e-141
 Identities = 241/266 (90%), Positives = 248/266 (92%)
 Frame = +3

Query: 63  MAAATMSLSSPAFAGKAVKNVSLSALFGEARVTMRKTTAKAKQVASSSPWYGADRVLYLG 242
           MAAATM+LSSPA AGKA   V     FGE R+TMRK+ AK K  AS SPWYGADRVLYLG
Sbjct: 1   MAAATMALSSPALAGKAAAKV-----FGEGRITMRKSAAKPKPAASGSPWYGADRVLYLG 55

Query: 243 PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA 422
           PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLA
Sbjct: 56  PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLA 115

Query: 423 RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG 602
           RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGG
Sbjct: 116 RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGG 175

Query: 603 PLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 782
           PLGE+VDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL
Sbjct: 176 PLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 235

Query: 783 ENLADHITDPVNNNAWAFATNFVPGK 860
           ENLADH+ DPVNNNAWA+ATNFVPGK
Sbjct: 236 ENLADHLADPVNNNAWAYATNFVPGK 261
  9629.m05067|protein  Chlorophyll A-B binding protein, putative
           Length = 265
           
 Score =  499 bits (1270), Expect = e-141
 Identities = 242/266 (90%), Positives = 252/266 (93%), Gaps = 2/266 (0%)
 Frame = +3

Query: 63  MAAATMSLSSPA-FAGKAVKNVSLSALFGEARVTMRKTTAKAKQVASS-SPWYGADRVLY 236
           MAA+TM+LSSPA  AGKAV N  +   FGE RVTMRK+ AK K  A+S SPWYGADRVLY
Sbjct: 1   MAASTMALSSPAALAGKAVANAKV---FGEGRVTMRKSAAKPKPAAASGSPWYGADRVLY 57

Query: 237 LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL 416
           LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL
Sbjct: 58  LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL 117

Query: 417 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIA 596
           LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIW CQVVLMGAVEGYR+A
Sbjct: 118 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWGCQVVLMGAVEGYRVA 177

Query: 597 GGPLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 776
           GGPLGE+VDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG
Sbjct: 178 GGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 237

Query: 777 PLENLADHITDPVNNNAWAFATNFVPGK 860
           PLENLADH+ DPVNNNAWA+ATNFVPGK
Sbjct: 238 PLENLADHLADPVNNNAWAYATNFVPGK 265
  9637.m01516|protein  chlorophyll a/b-binding protein I precursor -
           rice
           Length = 265
           
 Score =  495 bits (1260), Expect = e-140
 Identities = 243/266 (91%), Positives = 252/266 (94%), Gaps = 1/266 (0%)
 Frame = +3

Query: 63  MAAATMSLSSPAFAGKAVKNVSLSALFGEARVTMRKTTAKAKQVASS-SPWYGADRVLYL 239
           MAAATM+LSSP  A +A  + S SALFGEAR+TMRKT AK K  ASS SPWYGADRVLYL
Sbjct: 1   MAAATMALSSPVMA-RAAPSTS-SALFGEARITMRKTAAKPKPAASSGSPWYGADRVLYL 58

Query: 240 GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELL 419
           GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL
Sbjct: 59  GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL 118

Query: 420 ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAG 599
           ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAG
Sbjct: 119 ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAG 178

Query: 600 GPLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 779
           GPLGE+VDPLYPGG+FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP
Sbjct: 179 GPLGEVVDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 238

Query: 780 LENLADHITDPVNNNAWAFATNFVPGK 860
           LENLADH+ DPVNNNAWA+ATNFVPGK
Sbjct: 239 LENLADHLADPVNNNAWAYATNFVPGK 265
  9631.m03807|protein  chlorophyll a/b binding protein
           Length = 263
           
 Score =  414 bits (1054), Expect = e-115
 Identities = 200/264 (75%), Positives = 224/264 (84%), Gaps = 2/264 (0%)
 Frame = +3

Query: 69  AATMSLSSPAFAGKAVKNVSLSALFGEA--RVTMRKTTAKAKQVASSSPWYGADRVLYLG 242
           AA+    + +F G A +   L    G++  R+TMR+T   A Q    S WYG DR  YLG
Sbjct: 2   AASALHQTTSFLGTAPRRDELVRRVGDSGGRITMRRTVKSAPQ----SIWYGPDRPKYLG 57

Query: 243 PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA 422
           P S + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+
Sbjct: 58  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS 117

Query: 423 RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG 602
           +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LVHAQSILAIWA QVVLMG VEGYR+ GG
Sbjct: 118 KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG 177

Query: 603 PLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 782
           PLGE +D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct: 178 PLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI 237

Query: 783 ENLADHITDPVNNNAWAFATNFVPGK 860
           ENL DH+ DPV NNAWA+ATNFVPGK
Sbjct: 238 ENLFDHVADPVANNAWAYATNFVPGK 263
  9635.m03724|protein  chlorophyll a-b binding protein of lhcii type
           iii, chloroplastprecursor (cab)
           Length = 266
           
 Score =  343 bits (871), Expect = 3e-94
 Identities = 179/268 (66%), Positives = 199/268 (73%), Gaps = 2/268 (0%)
 Frame = +3

Query: 54  SSPMAAATMSLSSPAFAGKAVKNVSLSALFGEARVTMRKTTAKAKQVASSSPWYGADRVL 233
           S  +AA T  L  P  +   V++++ +A     R+TM K             WYG DRV 
Sbjct: 10  SRVLAAKTPFLGHPRPSNAPVRDIAAAAT---GRITMSKEL-----------WYGPDRVK 55

Query: 234 YLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPE 413
           YLGP S + PSYL GEFPGDYGWDTAGLSADPE FA+NR LEVIH RWAMLGALGC+ PE
Sbjct: 56  YLGPFSAQTPSYLRGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCITPE 115

Query: 414 LLAR-NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYR 590
           +L +   V F E VWFKAG+QIFS+GGLDYLGNP+LVHAQSILA+   QVVLMG VEGYR
Sbjct: 116 VLEKWVRVDFKEPVWFKAGAQIFSDGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGYR 175

Query: 591 IAGGPLGEIVDPLYPGGS-FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVT 767
           I G P     + LYPGG  FDPLGLADDP  FAELKVKEIKNGRLAMFSMFGFFVQAIVT
Sbjct: 176 INGLPGVGDGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVT 235

Query: 768 GKGPLENLADHITDPVNNNAWAFATNFVPG 857
           GKGPLENL DH+ DPV NNAW +AT F PG
Sbjct: 236 GKGPLENLLDHLADPVANNAWVYATKFTPG 265
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79162351 Number of Sequences: 59712 Number of extensions: 2248204 Number of successful extensions: 9141 Number of sequences better than 1.0e-10: 32 Number of HSP's better than 0.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 9086 Number of HSP's gapped (non-prelim): 20 length of query: 408 length of database: 26,991,925 effective HSP length: 51 effective length of query: 357 effective length of database: 23,946,613 effective search space: 8548940841 effective search space used: 8548940841 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG424   Members:35             3pri:Y   1e-127      
AAB18209.1       chlorophyll a/b-binding protein WCAB precursor
[Triticum aestivum]
         (1024 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9629.m05067|protein  Chlorophyll A-B binding protein, puta...   495  e-140
 9629.m03990|protein  Chlorophyll A-B binding protein, puta...   493  e-139
 9637.m01516|protein  chlorophyll a/b-binding protein I pre...   490  e-138
 9631.m03807|protein  chlorophyll a/b binding protein            413  e-115
 9635.m03724|protein  chlorophyll a-b binding protein of lh...   340  3e-93
 9637.m00977|protein  Chlorophyll A-B binding protein, puta...   217  3e-56
 9639.m01284|protein  chlorophyll a/b-binding protein CP26 ...   215  1e-55
 9634.m02114|protein  chlorophyll a/b-binding protein precu...   142  1e-33
 9635.m03882|protein  LHCI-680, photosystem I antenna prote...   137  3e-32
 9630.m05194|protein  light-harvesting complex protein [imp...   129  6e-30
 9630.m00958|protein  chlorophyll a/b-binding protein type ...   125  2e-28
 9637.m02343|protein  AY086461 PSI type II chlorophyll a/b-...   123  6e-28
 9639.m01283|protein  chlorophyll a/b-binding protein CP26 ...   118  2e-26
 9635.m03689|protein  probable chlorophyll a/b-binding prot...   114  2e-25
 9636.m03389|protein  chlorophyll a/b-binding protein presu...   108  2e-23
 9632.m03624|protein  chlorophyll a/b-binding apoprotein CP...    81  4e-15
 9630.m00957|protein  chlorophyll a/b-binding protein type ...    79  1e-14

  9629.m05067|protein  Chlorophyll A-B binding protein, putative
           Length = 265
           
 Score =  495 bits (1262), Expect = e-140
 Identities = 239/266 (89%), Positives = 254/266 (94%), Gaps = 2/266 (0%)
 Frame = +1

Query: 37  MAATTMSLSS-SSFAGKMVENIPSSALFGEARVTMRKTAAKAKQVS-SGSPWYGADRVLY 210
           MAA+TM+LSS ++ AGK V N   + +FGE RVTMRK+AAK K  + SGSPWYGADRVLY
Sbjct: 1   MAASTMALSSPAALAGKAVAN---AKVFGEGRVTMRKSAAKPKPAAASGSPWYGADRVLY 57

Query: 211 LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPEL 390
           LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIHCRWAMLGALGCVFPEL
Sbjct: 58  LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL 117

Query: 391 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVA 570
           LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIW CQVVLMGAVEGYRVA
Sbjct: 118 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWGCQVVLMGAVEGYRVA 177

Query: 571 GGPLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEVKNGRLAMFSMFGFFVQAIVTGKG 750
           GGPLGE+VDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKG
Sbjct: 178 GGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 237

Query: 751 PLENLADHIADPINNNAWAFATNFVPGK 834
           PLENLADH+ADP+NNNAWA+ATNFVPGK
Sbjct: 238 PLENLADHLADPVNNNAWAYATNFVPGK 265
  9629.m03990|protein  Chlorophyll A-B binding protein, putative
           Length = 261
           
 Score =  493 bits (1255), Expect = e-139
 Identities = 234/266 (87%), Positives = 248/266 (92%)
 Frame = +1

Query: 37  MAATTMSLSSSSFAGKMVENIPSSALFGEARVTMRKTAAKAKQVSSGSPWYGADRVLYLG 216
           MAA TM+LSS + AGK    +     FGE R+TMRK+AAK K  +SGSPWYGADRVLYLG
Sbjct: 1   MAAATMALSSPALAGKAAAKV-----FGEGRITMRKSAAKPKPAASGSPWYGADRVLYLG 55

Query: 217 PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLA 396
           PLSGEPPSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELLA
Sbjct: 56  PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLA 115

Query: 397 RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGG 576
           RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYR+AGG
Sbjct: 116 RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGG 175

Query: 577 PLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEVKNGRLAMFSMFGFFVQAIVTGKGPL 756
           PLGE+VDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPL
Sbjct: 176 PLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 235

Query: 757 ENLADHIADPINNNAWAFATNFVPGK 834
           ENLADH+ADP+NNNAWA+ATNFVPGK
Sbjct: 236 ENLADHLADPVNNNAWAYATNFVPGK 261
  9637.m01516|protein  chlorophyll a/b-binding protein I precursor -
           rice
           Length = 265
           
 Score =  490 bits (1249), Expect = e-138
 Identities = 238/266 (89%), Positives = 249/266 (93%), Gaps = 1/266 (0%)
 Frame = +1

Query: 37  MAATTMSLSSSSFAGKMVENIPSSALFGEARVTMRKTAAKAKQV-SSGSPWYGADRVLYL 213
           MAA TM+LSS   A        SSALFGEAR+TMRKTAAK K   SSGSPWYGADRVLYL
Sbjct: 1   MAAATMALSSPVMARAAPST--SSALFGEARITMRKTAAKPKPAASSGSPWYGADRVLYL 58

Query: 214 GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELL 393
           GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL
Sbjct: 59  GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL 118

Query: 394 ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAG 573
           ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYR+AG
Sbjct: 119 ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAG 178

Query: 574 GPLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEVKNGRLAMFSMFGFFVQAIVTGKGP 753
           GPLGE+VDPLYPGG+FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP
Sbjct: 179 GPLGEVVDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 238

Query: 754 LENLADHIADPINNNAWAFATNFVPGK 834
           LENLADH+ADP+NNNAWA+ATNFVPGK
Sbjct: 239 LENLADHLADPVNNNAWAYATNFVPGK 265
  9631.m03807|protein  chlorophyll a/b binding protein
           Length = 263
           
 Score =  413 bits (1049), Expect = e-115
 Identities = 198/263 (75%), Positives = 222/263 (84%)
 Frame = +1

Query: 46  TTMSLSSSSFAGKMVENIPSSALFGEARVTMRKTAAKAKQVSSGSPWYGADRVLYLGPLS 225
           TT  L ++    ++V  +  S      R+TMR+T   A Q    S WYG DR  YLGP S
Sbjct: 9   TTSFLGTAPRRDELVRRVGDSG----GRITMRRTVKSAPQ----SIWYGPDRPKYLGPFS 60

Query: 226 GEPPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNG 405
            + PSYLTGEFPGDYGWDTAGLSADPETF++NRELEVIH RWAMLGALGCVFPE+L++NG
Sbjct: 61  EQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNG 120

Query: 406 VKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLG 585
           VKFGEAVWFKAG+QIFSEGGLDYLGNP+LVHAQSILAIWA QVVLMG VEGYRV GGPLG
Sbjct: 121 VKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLG 180

Query: 586 EIVDPLYPGGSFDPLGLADDPEAFAELKVKEVKNGRLAMFSMFGFFVQAIVTGKGPLENL 765
           E +D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL
Sbjct: 181 EGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENL 240

Query: 766 ADHIADPINNNAWAFATNFVPGK 834
            DH+ADP+ NNAWA+ATNFVPGK
Sbjct: 241 FDHVADPVANNAWAYATNFVPGK 263
  9635.m03724|protein  chlorophyll a-b binding protein of lhcii type
           iii, chloroplastprecursor (cab)
           Length = 266
           
 Score =  340 bits (862), Expect = 3e-93
 Identities = 177/265 (66%), Positives = 200/265 (74%), Gaps = 5/265 (1%)
 Frame = +1

Query: 37  MAATTMSLSSSSFAGK---MVENIPSSALFGEARVTMRKTAAKAKQVSSGSPWYGADRVL 207
           MA+T M+ +S   A K   +    PS+A   +        AA  +   S   WYG DRV 
Sbjct: 1   MASTIMAPTSRVLAAKTPFLGHPRPSNAPVRDIAA-----AATGRITMSKELWYGPDRVK 55

Query: 208 YLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPE 387
           YLGP S + PSYL GEFPGDYGWDTAGLSADPE F++NR LEVIH RWAMLGALGC+ PE
Sbjct: 56  YLGPFSAQTPSYLRGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCITPE 115

Query: 388 LLAR-NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYR 564
           +L +   V F E VWFKAG+QIFS+GGLDYLGNP+LVHAQSILA+   QVVLMG VEGYR
Sbjct: 116 VLEKWVRVDFKEPVWFKAGAQIFSDGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGYR 175

Query: 565 VAGGPLGEIVDPLYPGGS-FDPLGLADDPEAFAELKVKEVKNGRLAMFSMFGFFVQAIVT 741
           + G P     + LYPGG  FDPLGLADDP  FAELKVKE+KNGRLAMFSMFGFFVQAIVT
Sbjct: 176 INGLPGVGDGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVT 235

Query: 742 GKGPLENLADHIADPINNNAWAFATNFVPG 831
           GKGPLENL DH+ADP+ NNAW +AT F PG
Sbjct: 236 GKGPLENLLDHLADPVANNAWVYATKFTPG 265
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68438651 Number of Sequences: 59712 Number of extensions: 1974432 Number of successful extensions: 8627 Number of sequences better than 1.0e-10: 34 Number of HSP's better than 0.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 8571 Number of HSP's gapped (non-prelim): 22 length of query: 341 length of database: 26,991,925 effective HSP length: 51 effective length of query: 289 effective length of database: 23,946,613 effective search space: 6920571157 effective search space used: 6920571157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG454   Members:2              3pri:Y   .052        
BAB90465.1       P0510C12.9 [Oryza sativa (japonica cultivar-group)]
dbj|BAB92803.1| P0039G05.22 [Oryza sativa (japonica cultiv
         (530 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9629.m04344|protein  hypothetical protein                        75  1e-13

  9629.m04344|protein  hypothetical protein
           Length = 101
           
 Score = 74.9 bits (181), Expect = 1e-13
 Identities = 57/99 (57%), Positives = 62/99 (62%), Gaps = 13/99 (13%)
 Frame = +2

Query: 137 MASLKAVKPTGLEGQAKEPTKVSATKGPAKLSNTATKPAAAKGGIKKAESKPREPKKRQV 316
           MASLKAVKP GL   AKEP         AKLS TATKPAAAKGG+KKAE KPREPKK   
Sbjct: 1   MASLKAVKPAGL---AKEPA--------AKLSETATKPAAAKGGVKKAEQKPREPKK--- 46

Query: 317 KSTKPAAAKN*QRQQENGACIAI-------------SMVL*IIYESCLSLPL 433
           KS      K+ + QQ  G+   I             S  +   YES LSLPL
Sbjct: 47  KSFGYFHVKSGEEQQAGGSQKLIVATGEMEIVRGSPSYAMLWDYESRLSLPL 98
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30273102 Number of Sequences: 59712 Number of extensions: 712559 Number of successful extensions: 2909 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2908 Number of HSP's gapped (non-prelim): 1 length of query: 176 length of database: 26,991,925 effective HSP length: 49 effective length of query: 127 effective length of database: 24,066,037 effective search space: 3056386699 effective search space used: 3056386699 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 155 (64.8 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG495   Members:30             3pri:Y   1e-115      
P40880           Carbonic anhydrase, chloroplast precursor (Carbonate
dehydratase) pir||T04478 probable carbonate dehydratase (
         (1774 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9629.m04324|protein  Carbonic anhydrase, putative               407  e-113
 9629.m04323|protein  Carbonic anhydrase, putative               370  e-102
 9637.m02550|protein  carbonate dehydratase, putative            186  1e-46
 9637.m02548|protein  carbonate dehydratase, putative            182  2e-45
 9637.m02549|protein  carbonate dehydratase, putative            182  2e-45
 9637.m02551|protein  carbonate dehydratase, putative            117  5e-26
 9632.m01958|protein  plant integral membrane protein TIGR0...   115  3e-25
 9629.m04325|protein  retrotransposon protein, putative, un...    92  3e-18

  9629.m04324|protein  Carbonic anhydrase, putative
            Length = 262
            
 Score =  407 bits (1035), Expect = e-113
 Identities = 206/261 (78%), Positives = 222/261 (84%), Gaps = 6/261 (2%)
 Frame = +2

Query: 245  MSGCLCLPCCYKK------SPAPAPAGENNKPAAAAAAAAAAIDSSSSSLIQKPTYHPPP 406
            MSGCLCLP  YKK      SP P  A    + AAAAAA   +IDSSSS  +     HPPP
Sbjct: 1    MSGCLCLPR-YKKAPNGTPSPPPPAAAAEAEAAAAAAATKPSIDSSSSPSLLTNN-HPPP 58

Query: 407  PPPSNKMDAAVERLKTGFEKFKTEVYDKKPDFFEPLKAGQAPKYMVFACADSRVCPSVTL 586
                +KMDAAV+RLK GF KFKTE YDKKP+ FEPLKAGQAPKYMVF+CADSRVCPSVT+
Sbjct: 59   ----SKMDAAVDRLKDGFAKFKTEFYDKKPELFEPLKAGQAPKYMVFSCADSRVCPSVTM 114

Query: 587  GLEPGEAFTIRNIANMVPAYCKNKYAGVGSAIEYAVCALKVEVIVVIGHSRCGGIKALLS 766
            GLEPGEAFT+RNIANMVPAYCK K+AGVGSAIEYAVCALKVE+IVVIGHSRCGGIKALLS
Sbjct: 115  GLEPGEAFTVRNIANMVPAYCKIKHAGVGSAIEYAVCALKVELIVVIGHSRCGGIKALLS 174

Query: 767  LKDGADDSFHFVEDWVRIGFPAKKKVQTECASMPFDDQCTVLEKEAVNVSLQNLLTYPFV 946
            LKDGA DSFHFVEDWVR GFPAKKKVQTE AS+PFDDQC +LEKEAVN SL+NL TYPFV
Sbjct: 175  LKDGAPDSFHFVEDWVRTGFPAKKKVQTEHASLPFDDQCAILEKEAVNQSLENLKTYPFV 234

Query: 947  KEGVTNGTLKLVGGHYDFVSGKFETWE 1027
            KEG+ NGTLKLVGGHYDFVSG  + WE
Sbjct: 235  KEGIANGTLKLVGGHYDFVSGNLDLWE 261
  9629.m04323|protein  Carbonic anhydrase, putative
            Length = 272
            
 Score =  370 bits (941), Expect = e-102
 Identities = 183/235 (77%), Positives = 204/235 (85%), Gaps = 11/235 (4%)
 Frame = +2

Query: 323  AAAAAAAAAAIDSSSSS-----------LIQKPTYHPPPPPPSNKMDAAVERLKTGFEKF 469
            A+ A+ + ++  SSS+S           +   P +  P  P +  MDAAV+RLK GF KF
Sbjct: 28   ASLASPSPSSSSSSSNSSNLPAPFRPRLIRNTPVFAAPVAPAA--MDAAVDRLKDGFAKF 85

Query: 470  KTEVYDKKPDFFEPLKAGQAPKYMVFACADSRVCPSVTLGLEPGEAFTIRNIANMVPAYC 649
            KTE YDKKP+ FEPLKAGQAPKYMVF+CADSRVCPSVT+GLEPGEAFT+RNIANMVPAYC
Sbjct: 86   KTEFYDKKPELFEPLKAGQAPKYMVFSCADSRVCPSVTMGLEPGEAFTVRNIANMVPAYC 145

Query: 650  KNKYAGVGSAIEYAVCALKVEVIVVIGHSRCGGIKALLSLKDGADDSFHFVEDWVRIGFP 829
            K K+AGVGSAIEYAVCALKVE+IVVIGHSRCGGIKALLSLKDGA DSFHFVEDWVR GFP
Sbjct: 146  KIKHAGVGSAIEYAVCALKVELIVVIGHSRCGGIKALLSLKDGAPDSFHFVEDWVRTGFP 205

Query: 830  AKKKVQTECASMPFDDQCTVLEKEAVNVSLQNLLTYPFVKEGVTNGTLKLVGGHYDFVSG 1009
            AKKKVQTE AS+PFDDQC +LEKEAVN SL+NL TYPFVKEG+ NGTLKLVGGHYDFVSG
Sbjct: 206  AKKKVQTEHASLPFDDQCAILEKEAVNQSLENLKTYPFVKEGIANGTLKLVGGHYDFVSG 265

Query: 1010 KFETWE 1027
              + WE
Sbjct: 266  NLDLWE 271
  9637.m02550|protein  carbonate dehydratase, putative
            Length = 333
            
 Score =  186 bits (467), Expect = 1e-46
 Identities = 123/342 (35%), Positives = 169/342 (48%), Gaps = 2/342 (0%)
 Frame = +2

Query: 2    RLTGATQPSRPVPAPPPSPPASAPPRPPPPPPSAPSSSGPPPSRPRPSHLHCNPSVHPSG 181
            RL  A   +R  PA   S   S PP P PP P        PP      HL    + H  G
Sbjct: 12   RLAAAAAAARAAPA---SVAHSPPPAPMPPQPC-------PPEDAALQHLR-RATGHDDG 60

Query: 182  ERREKREERRENKRVESR*LKMSGCLCLPCCYKKSPAPAPAGENNKPAAAAAAAAAAIDS 361
                                       +P   ++ P+  P    + P    A+     D 
Sbjct: 61   ---------------------------VPAAGEQPPSRRPIHRRDFPCTTMASR----DH 89

Query: 362  SSSSLIQKPTYHPPPPPPSNKMDAAVERLKTGFEKFKTEVYDKKPDFFEPLKAGQAPKYM 541
            S  +       H        + D  +E LK  F  FK          ++ L   Q PK+M
Sbjct: 90   SGLTRQLLDFQHGTVDEIDGEHDPFME-LKARFMDFKHRNCVDNISNYQNLAQQQTPKFM 148

Query: 542  VFACADSRVCPSVTLGLEPGEAFTIRNIANMVPAYCKNKYAGVGSAIEYAVCALKVEVIV 721
            V ACADSRVCPS  LG +PGEAFT+RNIAN+VP Y ++  +   +A+E+AV  L+VE ++
Sbjct: 149  VVACADSRVCPSSVLGFQPGEAFTVRNIANLVPPY-QHGASETSAALEFAVNTLEVENVL 207

Query: 722  VIGHSRCGGIKALLSLKDGADDSFH--FVEDWVRIGFPAKKKVQTECASMPFDDQCTVLE 895
            V+GHSRCGGI+AL+S+K   DDS    F+ DWV I   A+   +    ++ F+ QC   E
Sbjct: 208  VVGHSRCGGIQALMSMKSKQDDSQSRSFIRDWVSIAKSARLSTEAAAGNLNFELQCKHCE 267

Query: 896  KEAVNVSLQNLLTYPFVKEGVTNGTLKLVGGHYDFVSGKFETWE 1027
            KE++N SL NLLTYP++++ V  GTL L GG+Y+F+   FE W+
Sbjct: 268  KESINSSLLNLLTYPWIEKRVNEGTLSLHGGYYNFIDCTFEKWK 311
  9637.m02548|protein  carbonate dehydratase, putative
            Length = 250
            
 Score =  182 bits (457), Expect = 2e-45
 Identities = 93/194 (47%), Positives = 128/194 (65%), Gaps = 2/194 (1%)
 Frame = +2

Query: 446  LKTGFEKFKTEVYDKKPDFFEPLKAGQAPKYMVFACADSRVCPSVTLGLEPGEAFTIRNI 625
            LK  F  FK          ++ L   Q PK+MV ACADSRVCPS  LG +PGEAFT+RNI
Sbjct: 34   LKARFMDFKHRNCVDNISNYQNLAQQQTPKFMVVACADSRVCPSSVLGFQPGEAFTVRNI 93

Query: 626  ANMVPAYCKNKYAGVGSAIEYAVCALKVEVIVVIGHSRCGGIKALLSLKDGADDSFH--F 799
            AN+VP Y ++  +   +A+E+AV  L+VE ++V+GHSRCGGI+AL+S+K   DDS    F
Sbjct: 94   ANLVPPY-QHGASETSAALEFAVNTLEVENVLVVGHSRCGGIQALMSMKSKQDDSQSRSF 152

Query: 800  VEDWVRIGFPAKKKVQTECASMPFDDQCTVLEKEAVNVSLQNLLTYPFVKEGVTNGTLKL 979
            + DWV I   A+   +    ++ F+ QC   EKE++N SL NLLTYP++++ V  GTL L
Sbjct: 153  IRDWVSIAKSARLSTEAAAGNLNFELQCKHCEKESINSSLLNLLTYPWIEKRVNEGTLSL 212

Query: 980  VGGHYDFVSGKFETWE 1027
             GG+Y+F+   FE W+
Sbjct: 213  HGGYYNFIDCTFEKWK 228
  9637.m02549|protein  carbonate dehydratase, putative
            Length = 306
            
 Score =  182 bits (457), Expect = 2e-45
 Identities = 93/194 (47%), Positives = 128/194 (65%), Gaps = 2/194 (1%)
 Frame = +2

Query: 446  LKTGFEKFKTEVYDKKPDFFEPLKAGQAPKYMVFACADSRVCPSVTLGLEPGEAFTIRNI 625
            LK  F  FK          ++ L   Q PK+MV ACADSRVCPS  LG +PGEAFT+RNI
Sbjct: 90   LKARFMDFKHRNCVDNISNYQNLAQQQTPKFMVVACADSRVCPSSVLGFQPGEAFTVRNI 149

Query: 626  ANMVPAYCKNKYAGVGSAIEYAVCALKVEVIVVIGHSRCGGIKALLSLKDGADDSFH--F 799
            AN+VP Y ++  +   +A+E+AV  L+VE ++V+GHSRCGGI+AL+S+K   DDS    F
Sbjct: 150  ANLVPPY-QHGASETSAALEFAVNTLEVENVLVVGHSRCGGIQALMSMKSKQDDSQSRSF 208

Query: 800  VEDWVRIGFPAKKKVQTECASMPFDDQCTVLEKEAVNVSLQNLLTYPFVKEGVTNGTLKL 979
            + DWV I   A+   +    ++ F+ QC   EKE++N SL NLLTYP++++ V  GTL L
Sbjct: 209  IRDWVSIAKSARLSTEAAAGNLNFELQCKHCEKESINSSLLNLLTYPWIEKRVNEGTLSL 268

Query: 980  VGGHYDFVSGKFETWE 1027
             GG+Y+F+   FE W+
Sbjct: 269  HGGYYNFIDCTFEKWK 284
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 127460182 Number of Sequences: 59712 Number of extensions: 4637041 Number of successful extensions: 176762 Number of sequences better than 1.0e-10: 16 Number of HSP's better than 0.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 176714 Number of HSP's gapped (non-prelim): 19 length of query: 591 length of database: 26,991,925 effective HSP length: 53 effective length of query: 537 effective length of database: 23,827,189 effective search space: 12795200493 effective search space used: 12795200493 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 161 (67.1 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG515   Members:3              3pri:N   1e-73       
AAG13467.1       putative proline oxidase [Oryza sativa (japonica
cultivar-group)] gb|AAP54933.1| putative proline oxidase [Ory
         (557 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9638.m03659|protein  putative proline oxidase                   314  1e-85

  9638.m03659|protein  putative proline oxidase
           Length = 490
           
 Score =  314 bits (795), Expect = 1e-85
 Identities = 156/185 (84%), Positives = 170/185 (91%), Gaps = 1/185 (0%)
 Frame = +2

Query: 2   LTAEEERELQLAHDRLLAVGARCAEHDIPLLVDAEYASVQPSIDYFTFVGALACNGGGRP 181
           L AEEEREL++AH RLLA+G RCAE+DIPLLVDAEYA+VQP+IDYFTF GALA NGGGRP
Sbjct: 239 LEAEEERELEMAHGRLLAIGERCAEYDIPLLVDAEYATVQPAIDYFTFAGALAFNGGGRP 298

Query: 182 IVHGTVQAYLRDARDRLDAMVRAAEEERVCLGVKIVRGAYLTREARLAESLGVPSPIHGS 361
           IVHGTVQAYLRDARDRL+AM RAA+ ERVCL +K+VRGAYL REARLA SLGVPSP+H S
Sbjct: 299 IVHGTVQAYLRDARDRLEAMARAAQGERVCLALKLVRGAYLAREARLAASLGVPSPVHRS 358

Query: 362 IQDTHDCYNGCAAFLLERVRRGSASVMLATHNVESGQLAAARAQELGI-GKGDRNLQFAQ 538
           IQDTHDCYNGCAAFLL+RVRRG+A+V LATHNVESGQLAAARA ELGI G GDR LQFAQ
Sbjct: 359 IQDTHDCYNGCAAFLLDRVRRGAAAVTLATHNVESGQLAAARALELGIGGGGDRGLQFAQ 418

Query: 539 LMGMAD 556
           LMGMAD
Sbjct: 419 LMGMAD 424
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46644594 Number of Sequences: 59712 Number of extensions: 1663900 Number of successful extensions: 30056 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 30053 Number of HSP's gapped (non-prelim): 2 length of query: 185 length of database: 26,991,925 effective HSP length: 49 effective length of query: 136 effective length of database: 24,066,037 effective search space: 3272981032 effective search space used: 3272981032 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 156 (65.2 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG542   Members:74             3pri:Y   8e-42       
NP_197221.1      expressed protein [Arabidopsis thaliana]
dbj|BAB10506.1| gb|AAF26109.1~gene_id:MKP11.4~similar to unknown prot
         (900 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9630.m04919|protein  expressed protein                          256  3e-68
 9631.m01309|protein  T1N15.5                                     81  3e-15

  9630.m04919|protein  expressed protein
           Length = 132
           
 Score =  256 bits (648), Expect = 3e-68
 Identities = 126/132 (95%), Positives = 128/132 (96%)
 Frame = +3

Query: 171 MALEWVVLGYAAGAEAIMLLLLTLPGLDALRRGMISVVRSALKPMMSVVPFCLFLLMDIY 350
           MALEWVVLGYAAGAEAIMLLLLTLPGLD LRRGMISVVRSALKPMMSVVPFCLFLLMDIY
Sbjct: 1   MALEWVVLGYAAGAEAIMLLLLTLPGLDGLRRGMISVVRSALKPMMSVVPFCLFLLMDIY 60

Query: 351 WKYEMRPTCDDEHACTPSEHLRHQKSIMKSQRNALLIAAALLLYWILFSVTSLVVKLDHL 530
           WKYE RPTCDDEH CTPSEHLRHQKSIMKSQRNALLIAAALLLYWILFS+TSLVV+LD L
Sbjct: 61  WKYETRPTCDDEHHCTPSEHLRHQKSIMKSQRNALLIAAALLLYWILFSITSLVVRLDQL 120

Query: 531 QQRVDKLKKRDD 566
           QQRVDKLKKRDD
Sbjct: 121 QQRVDKLKKRDD 132
  9631.m01309|protein  T1N15.5
           Length = 180
           
 Score = 80.8 bits (196), Expect = 3e-15
 Identities = 50/129 (38%), Positives = 77/129 (58%), Gaps = 51/129 (39%)
 Frame = +3

Query: 171 MALEWVVLGYAAGAEAIMLLLLTLPGLDALRRGMISVVRSALKPMMSVVPFCLFLLMDIY 350
           MAL+W++L     AEA + ++LTLP   A+R+ ++ +    L+P   ++PF  F L+DIY
Sbjct: 1   MALQWMILACVVAAEAAVAVMLTLPAPRAVRKQIVGLTSMLLQPFAGILPFAAFQLLDIY 60

Query: 351 WKYEMRPTCDDEHACTPSEHLRHQKS---------------------------------- 428
           WK E R  C  E  CT  E +R +KS                                  
Sbjct: 61  WKNEHRLMCTSE-ICTADERIRFEKSELLLGKEENWPYFGNPLWPYIHHYSLRSGGIVCI 119

Query: 429 -----------------IMKSQRNALLIAAALLLYWILFSVTSLVVKLDHLQQRVDKLKK 557
                            I K+QRN +L  +A LLYW +F +      +  L++   +LK+
Sbjct: 120 CTSHTLKDVLLPDIECLIFKAQRNVILCVSACLLYWCIFRICKYNKDIKALEETEKRLKE 179
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66028042 Number of Sequences: 59712 Number of extensions: 2529481 Number of successful extensions: 75017 Number of sequences better than 1.0e-10: 4 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 75014 Number of HSP's gapped (non-prelim): 3 length of query: 300 length of database: 26,991,925 effective HSP length: 51 effective length of query: 248 effective length of database: 23,946,613 effective search space: 5938760024 effective search space used: 5938760024 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG565   Members:12             3pri:Y   2e-89       
O49818           Lactoylglutathione lyase (Methylglyoxalase)
(Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase)
         (1015 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9633.m02024|protein  lactoylglutathione lyase, putative         305  1e-82
 9630.m01682|protein  lactoylglutathione lyase, putative          83  6e-16
 9630.m01683|protein  lactoylglutathione lyase, putative          82  2e-15
 9633.m01239|protein  glyoxalase I, putative                      81  4e-15
 9630.m01684|protein  lactoylglutathione lyase, putative          78  3e-14
 9636.m00879|protein  lactoylglutathione lyase, putative          66  8e-11

  9633.m02024|protein  lactoylglutathione lyase, putative
           Length = 352
           
 Score =  305 bits (772), Expect = 1e-82
 Identities = 141/154 (91%), Positives = 146/154 (94%)
 Frame = +1

Query: 259 MFRVKDPKVSLDFYSRVMGMSLLKRLDFPEMKFSLYFLGYEDLSAAPVDPVQRTGWTFGQ 438
           MFRVKDPKVSLDFYSRVMGMSLLKRLDFPEMKFSLYFLGYED+ +AP DPV+RT WTFGQ
Sbjct: 199 MFRVKDPKVSLDFYSRVMGMSLLKRLDFPEMKFSLYFLGYEDVESAPTDPVKRTVWTFGQ 258

Query: 439 KATIELTHNWGTENDPEFKGYHNGNSDPRGFGHIGVTVDDVYKACERFERLGVEFVKKPD 618
           +AT+ELTHNWGTENDPEFKGYHNGNSDPRGFGHIGVTV DVYKACERFERLGVEFVKKPD
Sbjct: 259 RATLELTHNWGTENDPEFKGYHNGNSDPRGFGHIGVTVHDVYKACERFERLGVEFVKKPD 318

Query: 619 DGKMKGIAFIKDPDGYWIEIFDLKRIGEVTGTAS 720
           DGKMKGIAFIKDPDGYWIEIFDL RIG VT  AS
Sbjct: 319 DGKMKGIAFIKDPDGYWIEIFDLNRIGAVTAEAS 352
 Score = 83.1 bits (202), Expect = 7e-16
 Identities = 58/88 (65%), Positives = 64/88 (71%), Gaps = 3/88 (3%)
 Frame = +1

Query: 4   MPAASLLRSSLLLSS-HALRRLSSASASAPRGLRLAQPKGFGRSYPPALAAAAMSTSSGA 180
           M AA++  +SLL SS  ALRRLSSA+  +    R AQ K F R+   A  AAAMSTSSG 
Sbjct: 1   MAAAAIAAASLLPSSAFALRRLSSAANVS----RFAQLKRFDRARRFA-PAAAMSTSSGP 55

Query: 181 KEAPANNPGLQA--EVDPATKGYFMQQTMFR 267
           KEAPANNPGLQA  E DPATKGYFMQQT  R
Sbjct: 56  KEAPANNPGLQAPSEKDPATKGYFMQQTSGR 86
  9630.m01682|protein  lactoylglutathione lyase, putative
           Length = 345
           
 Score = 83.5 bits (203), Expect = 6e-16
 Identities = 74/228 (32%), Positives = 108/228 (46%), Gaps = 6/228 (2%)
 Frame = +1

Query: 1   AMPAASLLRSSLLLSSHALRRLSSASASAPRGLRLAQPKGFGRSYPPALAAAAMSTSSGA 180
           A  + ++ R SLLLS+       +A+A  P  +RL +    G S  P L A   S    A
Sbjct: 16  ACASPAVPRRSLLLST-------AAAALQPEPVRLTR----GASAAPKLRA---SPPDAA 61

Query: 181 KEAPANNPGLQAEVDPATKGYFMQQTMFRVKDPKVSLDFYSRVMGMSLLKRLDFPEMKFS 360
           + A A     +A     +    +   ++RV D   ++ FY+  +GM LL++ D PE K++
Sbjct: 62  QAAAAFGSKEEAFAWAKSDNRRLLHVVYRVGDIDRTIKFYTECLGMKLLRKRDIPEEKYT 121

Query: 361 LYFLGY--EDLSAAPVDPVQRTGWTFGQKATIELTHNWGTENDPEFKGYHNGNSDPRGFG 534
             FLGY  ED                     +ELT+N+G +       Y  G     GFG
Sbjct: 122 NAFLGYGAED-----------------NHFVVELTYNYGVDK------YDIG----AGFG 154

Query: 535 HIGVTVDDVYKACERFERLGVEFVKKPDDGKMKG----IAFIKDPDGYWIEIFD 684
           H G+ VDDV K  E     G +  ++P  G +KG    IAF++DPDGY  EI +
Sbjct: 155 HFGIAVDDVAKTVELIRAKGGKVTREP--GPVKGGKTVIAFVEDPDGYKFEILE 206
  9630.m01683|protein  lactoylglutathione lyase, putative
           Length = 377
           
 Score = 81.9 bits (199), Expect = 2e-15
 Identities = 69/211 (32%), Positives = 99/211 (46%), Gaps = 6/211 (2%)
 Frame = +1

Query: 52  ALRRLSSASASAPRGLRLAQPKGFGRSYPPALAAAAMSTSSGAKEAPANNPGLQAEVDPA 231
           A+R L   +A  P  +RL +    G S  P L A   S    A+ A A     +A     
Sbjct: 58  AVRLLGWTAALQPEPVRLTR----GASAAPKLRA---SPPDAAQAAAAFGSKEEAFAWAK 110

Query: 232 TKGYFMQQTMFRVKDPKVSLDFYSRVMGMSLLKRLDFPEMKFSLYFLGY--EDLSAAPVD 405
           +    +   ++RV D   ++ FY+  +GM LL++ D PE K++  FLGY  ED       
Sbjct: 111 SDNRRLLHVVYRVGDIDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGAED------- 163

Query: 406 PVQRTGWTFGQKATIELTHNWGTENDPEFKGYHNGNSDPRGFGHIGVTVDDVYKACERFE 585
                         +ELT+N+G +       Y  G     GFGH G+ VDDV K  E   
Sbjct: 164 ----------NHFVVELTYNYGVDK------YDIG----AGFGHFGIAVDDVAKTVELIR 203

Query: 586 RLGVEFVKKPDDGKMKG----IAFIKDPDGYWIEIFD 684
             G +  ++P  G +KG    IAF++DPDGY  EI +
Sbjct: 204 AKGGKVTREP--GPVKGGKTVIAFVEDPDGYKFEILE 238
  9633.m01239|protein  glyoxalase I, putative
           Length = 313
           
 Score = 80.8 bits (196), Expect = 4e-15
 Identities = 74/228 (32%), Positives = 109/228 (47%), Gaps = 8/228 (3%)
 Frame = +1

Query: 1   AMPAASLLRSSLLLSSHALRR---LSSASASAPRGLRLAQPKGFGRSYPPALAAAAMSTS 171
           A  AAS LR  +L SS A R         A+A   +RLA+           ++A A +  
Sbjct: 11  AAAAASRLRLPVLSSSVARREALLFGGRVAAARAPVRLARR---------GVSAGAEAGG 61

Query: 172 SGAKEAPANNPGLQAEVDPATKGYF-MQQTMFRVKDPKVSLDFYSRVMGMSLLKRLDFPE 348
           S +  A A   G    V+   K    M   ++RV D   ++ FY+  +GM LL++ D PE
Sbjct: 62  SSSAAAAAQVIGQDEAVEWVKKDRRRMLHVVYRVGDLDKTIKFYTECLGMKLLRKRDIPE 121

Query: 349 MKFSLYFLGYEDLSAAPVDPVQRTGWTFGQKATIELTHNWGTENDPEFKGYHNGNSDPRG 528
            +++  FLGY      P D              +ELT+N+G E+      Y  G +    
Sbjct: 122 ERYTNAFLGY-----GPED----------SHFVVELTYNYGVES------YDIGTA---- 156

Query: 529 FGHIGVTVDDVYKACERFERLGVEFVKKPDDGKMKG----IAFIKDPDGYWIEIFD 684
           FGH G+ V+DV K  +  +  G    ++P  G +KG    IAFI+DPDGY  E+ +
Sbjct: 157 FGHFGIAVEDVAKTVDLIKAKGGTVTREP--GPVKGGKSVIAFIEDPDGYKFELIE 210
  9630.m01684|protein  lactoylglutathione lyase, putative
           Length = 290
           
 Score = 77.6 bits (188), Expect = 3e-14
 Identities = 62/186 (33%), Positives = 87/186 (46%), Gaps = 6/186 (3%)
 Frame = +1

Query: 127 RSYPPALAAAAMSTSSGAKEAPANNPGLQAEVDPATKGYFMQQTMFRVKDPKVSLDFYSR 306
           R+ P A AAA  S       A ++N  L                ++RV D   ++ FY+ 
Sbjct: 2   RALPMAAAAAFGSKEEAFAWAKSDNRRLL-------------HVVYRVGDIDRTIKFYTE 48

Query: 307 VMGMSLLKRLDFPEMKFSLYFLGY--EDLSAAPVDPVQRTGWTFGQKATIELTHNWGTEN 480
            +GM LL++ D PE K++  FLGY  ED                     +ELT+N+G + 
Sbjct: 49  CLGMKLLRKRDIPEEKYTNAFLGYGAED-----------------NHFVVELTYNYGVDK 91

Query: 481 DPEFKGYHNGNSDPRGFGHIGVTVDDVYKACERFERLGVEFVKKPDDGKMKG----IAFI 648
                 Y  G     GFGH G+ VDDV K  E     G +  ++P  G +KG    IAF+
Sbjct: 92  ------YDIG----AGFGHFGIAVDDVAKTVELIRAKGGKVTREP--GPVKGGKTVIAFV 139

Query: 649 KDPDGYWIEIFD 684
           +DPDGY  EI +
Sbjct: 140 EDPDGYKFEILE 151
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71934185 Number of Sequences: 59712 Number of extensions: 2501851 Number of successful extensions: 83860 Number of sequences better than 1.0e-10: 12 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 83838 Number of HSP's gapped (non-prelim): 12 length of query: 338 length of database: 26,991,925 effective HSP length: 51 effective length of query: 286 effective length of database: 23,946,613 effective search space: 6848731318 effective search space used: 6848731318 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG592   Members:46             3pri:Y   1e-127      
CAE03504.1       OSJNBa0053K19.12 [Oryza sativa (japonica
cultivar-group)]
         (1552 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9632.m05164|protein  glycine cleavage system T protein          780  0.0
 9631.m03557|protein  putative protein kinase                     90  7e-18
 9633.m00004|protein  transposon protein, putative, CACTA, ...    80  1e-14
 9630.m00367|protein  transposon protein, putative, CACTA, ...    79  2e-14
 9629.m00111|protein  transposon protein, putative, CACTA, ...    77  9e-14
 9629.m00112|protein  transposon protein, putative, CACTA, ...    77  9e-14
 9635.m04045|protein  transposon protein, putative, CACTA, ...    71  4e-12
 9632.m03436|protein  transposon protein, putative, CACTA, ...    70  9e-12
 9639.m04036|protein  transposon protein, putative, CACTA, ...    70  9e-12
 9629.m05120|protein  retrotransposon protein, putative, Ty...    69  2e-11
 9636.m00525|protein  dna-directed rna polymerase ii larges...    69  2e-11
 9636.m00068|protein  transposon protein, putative, CACTA, ...    69  2e-11
 9631.m02812|protein  retrotransposon protein, putative, un...    69  2e-11
 9638.m00204|protein  transposon protein, putative, CACTA, ...    69  3e-11
 9633.m02231|protein  hypothetical protein                        68  4e-11

  9632.m05164|protein  glycine cleavage system T protein
            Length = 408
            
 Score =  780 bits (1993), Expect = 0.0
 Identities = 385/411 (93%), Positives = 395/411 (95%)
 Frame = +3

Query: 30   MRGLLACATLARRAAAASSTASSTAARRHLAGAAEVAEAELKKTALYDFHVAHGGKMVPF 209
            MRGLLACATLARRAA A+STA     RRHLAGAAE AEAELKKTALYDFHVAHGGKMVPF
Sbjct: 1    MRGLLACATLARRAAGATSTA-----RRHLAGAAEAAEAELKKTALYDFHVAHGGKMVPF 55

Query: 210  AGWSMPIQYKDTIMDSTLNCRANGSLFDVSHMCGLSLQGRQAIPFLESLVVADVAALKDG 389
            AGWSMPIQYKDTIMDSTLNCRANGSLFDVSHMCGLSL GRQAIPFLESLVVADVAALKDG
Sbjct: 56   AGWSMPIQYKDTIMDSTLNCRANGSLFDVSHMCGLSLHGRQAIPFLESLVVADVAALKDG 115

Query: 390  TGSLTVFTNDKGGAIDDSVVTKVNDHHVYLVVNAGCRDKDLAHIGAHMEAFQKKGGDVKW 569
            TG+LTVFTND+GGAIDDSVVTKV D H+YLVVNAGCRDKDLAHIG HMEAF KKGGDVKW
Sbjct: 116  TGTLTVFTNDRGGAIDDSVVTKVTDQHIYLVVNAGCRDKDLAHIGEHMEAFNKKGGDVKW 175

Query: 570  HVHDERSLLALQGPLAAPTLQLLTKEDLSKMYFSDFKMIDINGSACFLTRTGYTGEDGFE 749
            HVHDERSLLALQGPLAAPTLQLLTKEDLSKMYFSDFKMIDING ACFLTRTGYTGEDGFE
Sbjct: 176  HVHDERSLLALQGPLAAPTLQLLTKEDLSKMYFSDFKMIDINGYACFLTRTGYTGEDGFE 235

Query: 750  ISVPSENAVDLAKALLEKSEGKVRLTGLGARDSLRLEAGLCLYGNDMEQHITPVEAGLSW 929
            ISVPSENAVDLAKALLEKSEGKVRLTGLGARDSLRLEAGLCLYGNDMEQHITPVEAGLSW
Sbjct: 236  ISVPSENAVDLAKALLEKSEGKVRLTGLGARDSLRLEAGLCLYGNDMEQHITPVEAGLSW 295

Query: 930  AIGKRRRAEGGFLGAEVILKQLKEGPKIRRVGIFSQGPPPRSHSEIVSGAGENIGEVTSG 1109
            AIGKRR+AEGGFLGA+VILKQL+EGPKIRRVG+ SQGPPPRSHSEIVS +GENIGEVTSG
Sbjct: 296  AIGKRRKAEGGFLGADVILKQLQEGPKIRRVGLLSQGPPPRSHSEIVSNSGENIGEVTSG 355

Query: 1110 GFSPCLKKNIAMGYVKNGLHKAGTEFKVVVRGKQYDAVVTKMPFVPTKYYK 1262
            GFSPCLKKNIAMGYVK+GLHKAGTEFKVVVRGK YDAVVTKMPFVPTKYYK
Sbjct: 356  GFSPCLKKNIAMGYVKSGLHKAGTEFKVVVRGKSYDAVVTKMPFVPTKYYK 406
  9631.m03557|protein  putative protein kinase
           Length = 675
           
 Score = 90.5 bits (221), Expect = 7e-18
 Identities = 62/197 (31%), Positives = 88/197 (44%), Gaps = 2/197 (1%)
 Frame = +1

Query: 10  PSPTPPP*EASSRAPLWPAAPPPPPPRRPPPPRAATWPARRRWPRRSSRRRRCTTSTWRT 189
           PSP+PPP   +  +P  P  PPPPPP  PPPP  A+ P + + P   S+      ++   
Sbjct: 33  PSPSPPPPPPTPSSPQRP--PPPPPPATPPPPPPAS-PGKNQSPASPSQDSPPPVASPSV 89

Query: 190 GARWYPSPAGACPSSTRTPSWTPPSTAAPTAASSTSPTCAASACRAARPSPSSSPSSSPT 369
            +   P PA   P S   PS +PP  + P   SST P+  +       P PS S  ++  
Sbjct: 90  SS---PPPAPTTPPSPPPPSKSPPPPSPPPTTSSTPPSHQSPPEEGTSPPPSPSSGATTP 146

Query: 370 SPPSRTAPAPSPSSPTTRAAPSTTPSSPRSTTTTSTSSSTPAA--GTRTSPTSAPTWRRS 543
           SPP     + S S+P   A   T+P +PR   +  T  S P     T+  P   P     
Sbjct: 147 SPPPNAQSSSSSSTPP--AGAGTSPPAPREMPSPGTPPSPPTTLITTQAPPIQPPPPPGG 204

Query: 544 RRRVATSSGTSTTSAPSSP 600
              +  SS T+  ++ S P
Sbjct: 205 NSMIMPSSLTTAGTSQSPP 223
 Score = 82.3 bits (200), Expect = 2e-15
 Identities = 66/171 (38%), Positives = 84/171 (48%), Gaps = 8/171 (4%)
 Frame = +1

Query: 4   PPPSPTPPP*EASSRAPLWPAAPPPPP----PRRPPPPRAATWPARRRWPRRSSRRRRCT 171
           P   P  PP ++SS +P  P+ PPPPP    P+RPPPP     PA    P  +S  +   
Sbjct: 17  PAGGPPEPPPQSSSASPS-PSPPPPPPTPSSPQRPPPPPP---PATPPPPPPASPGKN-- 70

Query: 172 TSTWRTGARWYPSPAGACPSSTRTPSWTPPSTAAPTAASSTSPTCAASACRAARPSP--- 342
                       SPA   PS    P    PS ++P  A +T P+    +     PSP   
Sbjct: 71  -----------QSPAS--PSQDSPPPVASPSVSSPPPAPTTPPSPPPPSKSPPPPSPPPT 117

Query: 343 -SSSPSSSPTSPPSRTAPAPSPSSPTTRAAPSTTPSSPRSTTTTSTSSSTPAAGTRTSP 516
            SS+P S  + P   T+P PSPSS       +TTPS P     +S+SSSTP AG  TSP
Sbjct: 118 TSSTPPSHQSPPEEGTSPPPSPSS------GATTPSPP-PNAQSSSSSSTPPAGAGTSP 169
 Score = 69.9 bits (168), Expect = 1e-11
 Identities = 56/171 (32%), Positives = 75/171 (43%), Gaps = 1/171 (0%)
 Frame = +1

Query: 4   PPPSPTPPP*EASSRAPLWPAAPPPPPPRRPPPPRAATWPARRRWPRRSSRRRRCTTSTW 183
           PPP+PT PP      +P  P+  PPPP   PPP  ++T P+ +  P   +          
Sbjct: 92  PPPAPTTPP------SPPPPSKSPPPPS--PPPTTSSTPPSHQSPPEEGT---------- 133

Query: 184 RTGARWYPSPAGACPSSTRTPSWTPPSTAAPTAASSTSPTCAASACRAARPSPS-SSPSS 360
                   SP  +  S   TPS  PP  A  +++SST P  A ++  A R  PS  +P S
Sbjct: 134 --------SPPPSPSSGATTPS--PPPNAQSSSSSSTPPAGAGTSPPAPREMPSPGTPPS 183

Query: 361 SPTSPPSRTAPAPSPSSPTTRAAPSTTPSSPRSTTTTSTSSSTPAAGTRTSP 516
            PT+  +  AP   P  P        +   P S TT  TS S P A T  +P
Sbjct: 184 PPTTLITTQAPPIQPPPP----PGGNSMIMPSSLTTAGTSQSPPDATTAGAP 231
  9633.m00004|protein  transposon protein, putative, CACTA, En/Spm
           sub-class
           Length = 601
           
 Score = 79.6 bits (193), Expect = 1e-14
 Identities = 59/175 (33%), Positives = 79/175 (44%)
 Frame = +1

Query: 4   PPPSPTPPP*EASSRAPLWPAAPPPPPPRRPPPPRAATWPARRRWPRRSSRRRRCTTSTW 183
           PPP+  P P    S  P   A+PPPPPP  PPPPR +  P +                  
Sbjct: 59  PPPASPPLP----SATPPLAASPPPPPP--PPPPRNSPSPPKP----------------- 95

Query: 184 RTGARWYPSPAGACPSSTRTPSWTPPSTAAPTAASSTSPTCAASACRAARPSPSSSPSSS 363
                  PS A   P    T + TPP+  AP  A++  PT          PSP S+PS +
Sbjct: 96  -------PSQAAQSPLPPTTTTTTPPT--APVPAAAPPPTA---------PSPYSAPSPT 137

Query: 364 PTSPPSRTAPAPSPSSPTTRAAPSTTPSSPRSTTTTSTSSSTPAAGTRTSPTSAP 528
           PT  P+ T P PSP    T A  +   +  ++   +S  SS+PAA  RT+ +S+P
Sbjct: 138 PT--PTHTQPRPSPPLLPTPATAADPANPNKARHPSSNKSSSPAAPRRTNSSSSP 190
  9630.m00367|protein  transposon protein, putative, CACTA, En/Spm
            sub-class
            Length = 694
            
 Score = 78.8 bits (191), Expect = 2e-14
 Identities = 69/196 (35%), Positives = 95/196 (48%), Gaps = 23/196 (11%)
 Frame = +1

Query: 7    PPSPTPPP*EASSRAPLWPAAPPPPPPRRPPPPRAATWPARRRWPRRSSRRRRCTTSTWR 186
            PPS +P P    S +  +PA P    P  P PP +AT P+    P  SS     TT +  
Sbjct: 417  PPSSSPTP-SYPSPSSSYPAPPGSNTPSYPSPPSSATTPSSHSPPGGSS----STTPS-- 469

Query: 187  TGARWYPSPAGACPSSTRTPSWTPPSTAAPT----AASSTSPTCAASACRAARPSPSSSP 354
                 YPSP G  PS+   PS  PP +  P+     +SST+P+  +       PS  S P
Sbjct: 470  -----YPSPNGGKPSTPSHPS--PPGSTTPSYPSPPSSSTTPSYHSPPQGHTTPSHPSPP 522

Query: 355  SSSPTSPPSRTAPAPSPSSPTTRAAPST-TPSSPRST------------------TTTST 477
            SSS T+PPS + P  +P+ P+  + P T TP  P S                   +T  +
Sbjct: 523  SSS-TAPPSHSPPQSTPTHPSYPSPPVTYTPPPPTSADRPDVRFAPPPGSYGPIPSTPPS 581

Query: 478  SSSTPAAGTRTSPTSAPTWRRSRRRVATSSGTSTTSAPS 594
            S S P+  +   P S         +    +GT TT+ PS
Sbjct: 582  SGSPPSPSSGYQPPSGQPGASPPTQHVPGAGTPTTTPPS 620
 Score = 69.9 bits (168), Expect = 1e-11
 Identities = 63/186 (33%), Positives = 85/186 (44%), Gaps = 9/186 (4%)
 Frame = +1

Query: 43  SRAPLWPAAPPPPPPRRPP-----PPRAATWPARRRWPRRSSRRRRCTTSTWRTGARWYP 207
           S+A    A+  P P   P      PP   + P RRR P                    YP
Sbjct: 376 SKAQCQAASYTPTPGGSPGRGGQGPPAPVSSPPRRRGP--------------------YP 415

Query: 208 SPAGACPSSTRTPSWTPPSTAAPTAASSTSPTCAASACRAARPSPSSSPSSSPTSPPSRT 387
            P    PSS+ TPS+  PS++ P    S +P+  +    A  PS  S P  S ++ PS  
Sbjct: 416 QP----PSSSPTPSYPSPSSSYPAPPGSNTPSYPSPPSSATTPSSHSPPGGSSSTTPSYP 471

Query: 388 AP-APSPSSPTTRAAP-STTPS--SPRSTTTTSTSSSTPAAGTRTSPTSAPTWRRSRRRV 555
           +P    PS+P+  + P STTPS  SP S++TT +  S P   T  S  S P+   S    
Sbjct: 472 SPNGGKPSTPSHPSPPGSTTPSYPSPPSSSTTPSYHSPPQGHTTPSHPSPPS--SSTAPP 529

Query: 556 ATSSGTSTTSAPSSP 600
           + S   ST + PS P
Sbjct: 530 SHSPPQSTPTHPSYP 544
 Score = 68.7 bits (165), Expect = 3e-11
 Identities = 58/173 (33%), Positives = 83/173 (47%), Gaps = 10/173 (5%)
 Frame = +1

Query: 13  SPTPPP*EASSRAPLWPAAPPPPPPRR----PPPPRAATWPARRRWPRRSSRRRRCTTST 180
           S TP P  +  R    P AP   PPRR    P PP ++  P+                  
Sbjct: 384 SYTPTPGGSPGRGGQGPPAPVSSPPRRRGPYPQPPSSSPTPS------------------ 425

Query: 181 WRTGARWYPSPAGACPS--STRTPSW-TPPSTAAPTAASSTSPTCAASACRAARPSPSSS 351
                  YPSP+ + P+   + TPS+ +PPS+A  T  SS SP   +S+   + PSP+  
Sbjct: 426 -------YPSPSSSYPAPPGSNTPSYPSPPSSA--TTPSSHSPPGGSSSTTPSYPSPNGG 476

Query: 352 PSSSPT--SPP-SRTAPAPSPSSPTTRAAPSTTPSSPRSTTTTSTSSSTPAAGTRTSPTS 522
             S+P+  SPP S T   PSP S +T  +  + P    + +  S  SS+ A  + + P S
Sbjct: 477 KPSTPSHPSPPGSTTPSYPSPPSSSTTPSYHSPPQGHTTPSHPSPPSSSTAPPSHSPPQS 536

Query: 523 APT 531
            PT
Sbjct: 537 TPT 539
  9629.m00111|protein  transposon protein, putative, CACTA, En/Spm
           sub-class
           Length = 698
           
 Score = 76.9 bits (186), Expect = 9e-14
 Identities = 65/199 (32%), Positives = 87/199 (43%), Gaps = 3/199 (1%)
 Frame = +1

Query: 1   LPPPSPTPPP*EASSRAPLWPAA---PPPPPPRRPPPPRAATWPARRRWPRRSSRRRRCT 171
           +PPP+  PPP    +  P  P+A   PP PP   P PP  AT P     P+ S  ++   
Sbjct: 75  VPPPATVPPPPVPVASPPPTPSATLPPPSPPASVPVPPTPATTP-----PKPSPVQQPPV 129

Query: 172 TSTWRTGARWYPSPAGACPSSTRTPSWTPPSTAAPTAASSTSPTCAASACRAARPSPSSS 351
            ++         SPA   P +    S TPP   +P      SP    +   A  PSPS S
Sbjct: 130 AASPPPS-----SPADLPPPNPPARSDTPPVVQSPPPPHRRSPRTPWAPPMA--PSPSGS 182

Query: 352 PSSSPTSPPSRTAPAPSPSSPTTRAAPSTTPSSPRSTTTTSTSSSTPAAGTRTSPTSAPT 531
           P+    + PS  A  P   +P   ++P  TPS+P S T   T S+ P +G   SP +AP 
Sbjct: 183 PTKPSPASPSPIAGDPIIPTPNNPSSPLATPSAPGSGTPVVTPSA-PVSGP-PSPGTAPA 240

Query: 532 WRRSRRRVATSSGTSTTSAPSS 597
               R   + S  T   S  SS
Sbjct: 241 TAADRSNKSLSPNTQDGSVSSS 262
 Score = 67.1 bits (161), Expect = 8e-11
 Identities = 64/199 (32%), Positives = 84/199 (42%), Gaps = 8/199 (4%)
 Frame = +1

Query: 1   LPPPSPTPPP*EASSRAPLWPAAPPPPPPRRP---PPPRAATWPARRRWPRRSSRRRRCT 171
           + PP+ +PP   A++  P   + PP PPP  P   PPP     P     P   +      
Sbjct: 41  ITPPAASPPLPSAATPPPQPDSPPPSPPPAPPVAVPPPATVPPP-----PVPVASPPPTP 95

Query: 172 TSTWRTGARWYPSPAGACPSSTRTPSWTPPSTA---APTAASSTSPTCAASACRAARPSP 342
           ++T        PSP  + P    TP+ TPP  +    P  A+S  P+  A         P
Sbjct: 96  SATLPP-----PSPPASVPVPP-TPATTPPKPSPVQQPPVAASPPPSSPADL------PP 143

Query: 343 SSSPSSSPTSPPSRTAPAPSPSSPTTRAAPSTTPSSPRSTTTTSTSSSTPAAGTRTSPTS 522
            + P+ S T P  ++ P P   SP T  AP   PS   S T  S +S +P AG    PT 
Sbjct: 144 PNPPARSDTPPVVQSPPPPHRRSPRTPWAPPMAPSPSGSPTKPSPASPSPIAGDPIIPTP 203

Query: 523 APTWRRSRRRVATSSGTS--TTSAPSS 597
                      A  SGT   T SAP S
Sbjct: 204 NNPSSPLATPSAPGSGTPVVTPSAPVS 230
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 121895349 Number of Sequences: 59712 Number of extensions: 4831986 Number of successful extensions: 174227 Number of sequences better than 1.0e-10: 30 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 15 Number of HSP's that attempted gapping in prelim test: 171617 Number of HSP's gapped (non-prelim): 420 length of query: 517 length of database: 26,991,925 effective HSP length: 52 effective length of query: 464 effective length of database: 23,886,901 effective search space: 11083522064 effective search space used: 11083522064 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG600   Members:23             3pri:Y   3e-92       
A35275           carboxypeptidase C (EC 3.4.16.5) - barley
         (1933 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9630.m00134|protein  serine carboxypeptidase iii precursor...   889  0.0
 9635.m02886|protein  Serine carboxypeptidase, putative          698  0.0
 9633.m00589|protein  serine carboxypeptidase II-like protein    189  1e-47
 9629.m02211|protein  Serine carboxypeptidase                    187  6e-47
 9633.m04764|protein  Serine carboxypeptidase                    186  1e-46
 9629.m02212|protein  Serine carboxypeptidase                    185  2e-46
 9629.m01124|protein  Serine carboxypeptidase                    181  4e-45
 9631.m02651|protein  probable serine carboxypeptidase II [...   177  5e-44
 9629.m04229|protein  Serine carboxypeptidase                    174  6e-43
 9632.m02396|protein  serine carboxypeptidase i precursor (...   168  4e-41
 9634.m05001|protein  serine carboxypeptidase II-like protein    168  4e-41
 9633.m04762|protein  Serine carboxypeptidase                    166  1e-40
 9632.m00842|protein  Serine carboxypeptidase                    164  5e-40
 9632.m03105|protein  Serine carboxypeptidase                    162  2e-39
 9639.m02167|protein  carboxypeptidase, putative                 161  4e-39
 9629.m02207|protein  Serine carboxypeptidase, putative          161  4e-39
 9635.m04658|protein  Serine carboxypeptidase                    161  4e-39
 9634.m00816|protein  serine carboxypeptidase ii-2 precurso...   161  5e-39
 9640.m01504|protein  serine carboxypeptidase i precursor (...   151  3e-36
 9631.m00868|protein  probable serine carboxypeptidase II [...   150  6e-36

  9630.m00134|protein  serine carboxypeptidase iii precursor (ec
            3.4.16.5).
            Length = 500
            
 Score =  889 bits (2273), Expect = 0.0
 Identities = 433/501 (86%), Positives = 460/501 (91%), Gaps = 7/501 (1%)
 Frame = +3

Query: 162  VSLLLLLALCAAAAGA--LRLPPDASFPGAQAERLIRALNLLPKDSSSSSGRHGARVGAG 335
            VSL+LL+ + AA+A A  LRLP DA FP AQAERLIR+LNLLPK++  +        GAG
Sbjct: 6    VSLILLVVVLAASACAEGLRLPRDAKFPAAQAERLIRSLNLLPKEAGPT--------GAG 57

Query: 336  K-EDVAPGQLLERRVTLPGLPEGVADLGHHAGYYRLPNTHDARMFYFFFESRGKKEDPVV 512
                VAPG+LLERRVTLPGLP+GV DLGHHAGYYRLPNTHDARMFYF FESRGKKEDPVV
Sbjct: 58   DVPSVAPGELLERRVTLPGLPQGVGDLGHHAGYYRLPNTHDARMFYFLFESRGKKEDPVV 117

Query: 513  IWLTGGPGCSSELAVFYENGPFTIANNMSLVWNKFGWDKISNIIFVDQPTGTGFSYSSDD 692
            IWLTGGPGCSSELAVFYENGPFTI+NNMSL WNKFGWD ISNIIFVDQPTGTGFSYSSDD
Sbjct: 118  IWLTGGPGCSSELAVFYENGPFTISNNMSLAWNKFGWDTISNIIFVDQPTGTGFSYSSDD 177

Query: 693  RDTRHDETGVSNDLYDFLQVFFKKHPEFIKNDFFITGESYAGHYIPAFASRVHQGNKKNE 872
            RDTRHDETGVSNDLY FLQVFFKKHPEF KNDFFITGESYAGHYIPAFASRVHQGNK NE
Sbjct: 178  RDTRHDETGVSNDLYSFLQVFFKKHPEFAKNDFFITGESYAGHYIPAFASRVHQGNKANE 237

Query: 873  GTHINLKGFAIGNGLTDPAIQYKAYTDYALEMNLIQKADYERINKFIPPCEFAIKLCGTN 1052
            G HINLKGFAIGNGLTDPAIQYKAYTDYAL+MNLI+K+DY+RINKFIPPCEFAIKLCGTN
Sbjct: 238  GIHINLKGFAIGNGLTDPAIQYKAYTDYALDMNLIKKSDYDRINKFIPPCEFAIKLCGTN 297

Query: 1053 GKASCMAAYMVCNTIFNSIMKLVGTKNYYDVRKECEGKLCYDFSNLEKFFGDKAVRQAIG 1232
            GKASCMAAYMVCN+IF+SIMKLVGTKNYYDVRKECEGKLCYDFSNLEKFFGDKAV++AIG
Sbjct: 298  GKASCMAAYMVCNSIFSSIMKLVGTKNYYDVRKECEGKLCYDFSNLEKFFGDKAVKEAIG 357

Query: 1233 VGDIEFVSCSTSVYQAMLTDWMRNLEVGIPALLEDGINVLIYAGEYDLICNWLGNSRWVH 1412
            VGD+EFVSCST+VYQAMLTDWMRNLEVGIPALLEDGINVLIYAGEYDLICNWLGNSRWVH
Sbjct: 358  VGDLEFVSCSTTVYQAMLTDWMRNLEVGIPALLEDGINVLIYAGEYDLICNWLGNSRWVH 417

Query: 1413 SMEWSGQKDFAKTAESSFLVDDAQAGVLKSHGALSFLKVHNAGHMVPMDQPKAALEMLRR 1592
            SMEWSGQKDF  + ES F+VD A+AGVLKSHG LSFLKVHNAGHMVPMDQPKA+LEMLRR
Sbjct: 418  SMEWSGQKDFVSSHESPFVVDGAEAGVLKSHGPLSFLKVHNAGHMVPMDQPKASLEMLRR 477

Query: 1593 FTQGKLKE----AVPEEESSTTSFYAAM 1664
            FTQGKLKE     +PE+       YAAM
Sbjct: 478  FTQGKLKEEWLAELPEQ-----PMYAAM 500
  9635.m02886|protein  Serine carboxypeptidase, putative
            Length = 524
            
 Score =  698 bits (1782), Expect = 0.0
 Identities = 345/493 (69%), Positives = 396/493 (79%), Gaps = 26/493 (5%)
 Frame = +3

Query: 141  MATTPRLVSLLLLLALCAAAAGA-----------LRLP-------PDASFPGAQAERLIR 266
            M  T +  SLLL   L  AAA A           LRLP       P    P + A  LIR
Sbjct: 1    MGPTRQSHSLLLTFLLVGAAAAAAAASPEDGSPFLRLPTASDLPVPAGQLPRSAAVGLIR 60

Query: 267  ALNLLPKDSSSSSGRHGARVGAGKEDVAPGQLLERRVTLPGLPEGVA------DLGHHAG 428
            ALNL P+D+S S    G        DV  G L+ER + L  +  G +      DLGHHAG
Sbjct: 61   ALNLHPRDASPSPSSRG------DGDVPAGTLVERPIHLASMATGKSGGSSAEDLGHHAG 114

Query: 429  YYRLPNTHDARMFYFFFESRGKK--EDPVVIWLTGGPGCSSELAVFYENGPFTIANNMSL 602
            YYRLPNTHDAR+FYFFFESRG K  +DPVVIWLTGGPGCSSELA+FYENGPF IA+NMSL
Sbjct: 115  YYRLPNTHDARLFYFFFESRGSKGEDDPVVIWLTGGPGCSSELALFYENGPFHIADNMSL 174

Query: 603  VWNKFGWDKISNIIFVDQPTGTGFSYSSDDRDTRHDETGVSNDLYDFLQVFFKKHPEFIK 782
            VWN FGWD+ SN+I+VDQPTGTGFSYSS+ RDTRHDE GVSNDLY FLQ FF +HP F K
Sbjct: 175  VWNDFGWDQESNLIYVDQPTGTGFSYSSNPRDTRHDEAGVSNDLYAFLQAFFTEHPNFAK 234

Query: 783  NDFFITGESYAGHYIPAFASRVHQGNKKNEGTHINLKGFAIGNGLTDPAIQYKAYTDYAL 962
            NDF+ITGESYAGHYIPAFASRV++GNK +EG HINLKGFAIGNGLTDPAIQYKAYTDY+L
Sbjct: 235  NDFYITGESYAGHYIPAFASRVYKGNKNSEGIHINLKGFAIGNGLTDPAIQYKAYTDYSL 294

Query: 963  EMNLIQKADYERINKFIPPCEFAIKLCGTNGKASCMAAYMVCNTIFNSIMKLVGTKNYYD 1142
            +M LI K+ + RINK +P CE AIKLCGT+G  SC+ AY+VCN IF+SI  ++G KNYYD
Sbjct: 295  DMGLITKSQFNRINKIVPTCELAIKLCGTSGTISCLGAYVVCNLIFSSIETIIGKKNYYD 354

Query: 1143 VRKECEGKLCYDFSNLEKFFGDKAVRQAIGVGDIEFVSCSTSVYQAMLTDWMRNLEVGIP 1322
            +RK C G LCYD SN+EKF   K+VR+++GVGDI+FVSCS +VYQAML DWMRNLEVGIP
Sbjct: 355  IRKPCVGSLCYDLSNMEKFLQLKSVRESLGVGDIQFVSCSPTVYQAMLLDWMRNLEVGIP 414

Query: 1323 ALLEDGINVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFAKTAESSFLVDDAQAGVLKS 1502
             LLE+ I VLIYAGEYDLICNWLGNSRWV+SMEWSG++ F  ++E  F VD  +AG+LKS
Sbjct: 415  ELLENDIKVLIYAGEYDLICNWLGNSRWVNSMEWSGKEAFVSSSEEPFTVDGKEAGILKS 474

Query: 1503 HGALSFLKVHNAGHMVPMDQPKAALEMLRRFTQGKLKEA 1619
            +G LSFLKVH+AGHMVPMDQPK ALEML R+T G L  A
Sbjct: 475  YGPLSFLKVHDAGHMVPMDQPKVALEMLMRWTSGNLSNA 513
  9633.m00589|protein  serine carboxypeptidase II-like protein
            Length = 482
            
 Score =  189 bits (475), Expect = 1e-47
 Identities = 138/438 (31%), Positives = 224/438 (50%), Gaps = 35/438 (7%)
 Frame = +3

Query: 294  SSSSGRHGARVGAGKEDVAPGQLLERRVTLPGLPEGVADLGHHAGYYRLPNTHDARMFYF 473
            SSS    G   G G+++       +R   LPG P   A +   AGY  +   H   +FY+
Sbjct: 24   SSSMAATGGGGGGGEQEA------DRVARLPGQPASPA-VSQFAGYVGVDERHGRALFYW 76

Query: 474  FFESRGK---KEDPVVIWLTGGPGCSS-ELAVFYENGPFTIANN-MSLVWNKFGWDKISN 638
            FFE++     ++ P+++WL GGPGCSS       E GP  +A    +L +N++GW+K +N
Sbjct: 77   FFEAQASPAPEKKPLLLWLNGGPGCSSIGYGAASELGPLRVARQGAALEFNQYGWNKEAN 136

Query: 639  IIFVDQPTGTGFSYSSDDRDTRH-DETGVSNDLYDFLQVFFKKHPEFIKNDFFITGESYA 815
            ++F++ P G GFSY++   D  + ++  V+ D Y FL  +FK+ P++  N+F+I+GESYA
Sbjct: 137  LLFLESPVGVGFSYTNTSSDLSNLNDDFVAEDAYSFLVNWFKRFPQYKDNEFYISGESYA 196

Query: 816  GHYIPAFASRVHQGNK-KNEGTHINLKGFAIGNGLTDPAIQYKAYTDYALEMNLIQKADY 992
            GHY+P  A  V++ NK K   T+INLKGF +GN LTD     K   +YA    ++    Y
Sbjct: 197  GHYVPQLADLVYERNKDKRASTYINLKGFIVGNPLTDDYYDSKGLAEYAWSHAIVSDQVY 256

Query: 993  ERINKFIPPCEFAIKLCGTNGKASCMAAYMVCNTIFNSI--------------------M 1112
            ERI K    C F      +N    C AA  +  + +N I                     
Sbjct: 257  ERIKK---TCNFK----NSNWTDDCNAAMNIIFSQYNQIDIYNIYAPKCLLNSTSASSPD 309

Query: 1113 KLVGTKNYYDVRKECEGKLCYD---FSNLEKFFGDKAVRQAI-----GVGDIEFVSCSTS 1268
            +     N    R   +    YD    S  E +F    V++A      G+   ++  CS  
Sbjct: 310  RAFFANNQEQFRWRIKMFSGYDPCYSSYAEDYFNKHDVQEAFHANASGLLPGKWQVCSDQ 369

Query: 1269 VYQAMLTDWMRNLEVGIPALLEDGINVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFAK 1448
            +  +     +  L +    L++ G+ V +Y+G+ D     + +   V ++         K
Sbjct: 370  ILNSYNFSVLSILPI-YSKLIKAGLRVWLYSGDADGRVPVISSRYCVEALGLP-----IK 423

Query: 1449 TAESSFLVDDAQAGVLKSHGALSFLKVHNAGHMVPMDQPKAALEMLRRFTQGK 1607
            T   S+ +D   AG    +  ++ + V  AGH+VP+++P   L ++  F  G+
Sbjct: 424  TDWQSWYLDKQVAGRFVEYHGMTMVTVRGAGHLVPLNKPAEGLMLINAFLHGE 476
  9629.m02211|protein  Serine carboxypeptidase
            Length = 480
            
 Score =  187 bits (470), Expect = 6e-47
 Identities = 126/417 (30%), Positives = 219/417 (52%), Gaps = 32/417 (7%)
 Frame = +3

Query: 357  QLLERRVTLPGLPEGVADLGHHAGYYRLPNTHDARMFYFFFESRG-KKEDPVVIWLTGGP 533
            Q  +R   LPG P     +   +GY  + + +   +FY+FFE++    + P+++WL GGP
Sbjct: 36   QEADRVAFLPGQPRS-PQMSQFSGYITVNSQNGRALFYWFFEAQALPSKKPLLLWLNGGP 94

Query: 534  GCSSE-LAVFYENGPFTI-ANNMSLVWNKFGWDKISNIIFVDQPTGTGFSYSSDDRDTRH 707
            GCSS       E GP  +  N   L +NKF W+  +N++F++ P G GFSY++   D   
Sbjct: 95   GCSSVGYGAASELGPLMVNGNGTGLEFNKFAWNNEANLLFLESPVGVGFSYTNTSSDLES 154

Query: 708  -DETGVSNDLYDFLQVFFKKHPEFIKNDFFITGESYAGHYIPAFASRVHQGNKKNE-GTH 881
             D+  V+ D Y+FL  +FK+ P++  +DF+I+GESYAGHY+P  A  V++ NK  E   H
Sbjct: 155  IDDRFVAEDTYNFLVNWFKRFPQYKNHDFYISGESYAGHYVPQLADVVYERNKHVETNQH 214

Query: 882  INLKGFAIGNGLTDPAIQYKAYTDYALEMNLIQKADYERINKFIPPCEFAIKLCGTNGKA 1061
            INLKGF +GN  TD    YK   ++A   ++I    Y+ +N     C+F  +L   + + 
Sbjct: 215  INLKGFIVGNAETDDYYDYKGLVEFAWSHSVISDQLYKHVNNV---CDF--RLSPRSNEC 269

Query: 1062 SCMAAYMV---------------CNTIFNSIMKLVGTKNYYDVRKECEGKLCYD------ 1178
            + +  Y+                CNT  +S+     +    + +K  +G   Y       
Sbjct: 270  NHVMGYIYDQYDMIDIFNVYAPKCNTDDSSLFSTSYSTADMNAKKRLKGTRMYSGYDPCY 329

Query: 1179 FSNLEKFFGDKAVRQAIG------VGDIEFVSCSTSVYQAMLTDWMRNLEVGIPALLEDG 1340
             S++E +     V++++       + D ++  CS S++          L +    L++ G
Sbjct: 330  SSHIEDYMNKMDVQKSLHANTSGLIKDRKWSICSYSIFDNYDITVFSVLPI-YSKLIKAG 388

Query: 1341 INVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFAKTAESSFLVDDAQAGVLKSHGALSF 1520
            + + +Y+G+ D     +G+   V ++         K+    + +++  AG    +  L+ 
Sbjct: 389  LRIWVYSGDVDGRVPVIGSRYCVEALGLP-----VKSQWQPWYLNNQVAGRFVEYQGLTM 443

Query: 1521 LKVHNAGHMVPMDQPKAALEMLRRFTQGK 1607
              V  AGH VP D+P+ AL ++  F  G+
Sbjct: 444  ATVRGAGHAVPQDKPEQALVVINSFLSGR 472
  9633.m04764|protein  Serine carboxypeptidase
            Length = 442
            
 Score =  186 bits (468), Expect = 1e-46
 Identities = 130/389 (33%), Positives = 198/389 (50%), Gaps = 10/389 (2%)
 Frame = +3

Query: 420  HAGYYRLPNTHDARMFYFFFESRGK----KEDPVVIWLTGGPGCSSELAVFYENGPFTIA 587
            ++GY  +  T+ A +F+ ++E+          P+++WL GGPGCS     F+E GP+ + 
Sbjct: 39   NSGYLPITTTN-ASLFFAYYEATHPLTPPASTPLLLWLQGGPGCSGLAGNFFELGPYFVN 97

Query: 588  NN-MSLVWNKFGWDKISNIIFVDQPTGTGFSYSSDDRDTRHDETGVSNDLYDFLQVFFKK 764
             + +SL  N F W++   ++F+D P GTGFS +        +++ V+  L+  LQ FF  
Sbjct: 98   RDALSLSPNPFSWNRRFGLLFIDNPLGTGFSAAPSPAAIPTNQSVVAAHLFAALQSFFAL 157

Query: 765  HPEFIKNDFFITGESYAGHYIPAFASRVHQGNKK-NEGTHINLKGFAIGNGLTDPAIQYK 941
             P      FF+TGESYAG YIPA  S +   N        +NL G AIGNGLT P  Q  
Sbjct: 158  QPGSRSRPFFLTGESYAGKYIPAAGSYILAVNPTLPTRLRVNLHGVAIGNGLTHPVAQVA 217

Query: 942  AYTDYALEMNLI---QKADYERINKFIPPCEFAIKLCGTNGKASCMAAYMVCNTIFNSIM 1112
             + D A  M LI   QK + E +         A++L  TN  A    A      + + + 
Sbjct: 218  THADTAYFMGLINAKQKRELEALQ------ARAVEL--TNA-ARWSEAADARGLVLSWLE 268

Query: 1113 KLVGTKNYYDVRKECEGKLCYDFSNLEKFFGDKAVRQAIGV-GDIEFVSCSTSVYQAMLT 1289
               G    +D  K    K  Y+   + KF     V+ A+G  GD+E+  CS +V  AM  
Sbjct: 269  NATGLATLFDAAK----KRPYETGPVGKFVNRAEVKAALGARGDVEWEECSDAVGAAMHG 324

Query: 1290 DWMRNLEVGIPALLEDGINVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFAKTAESSFL 1469
            D M++++  + ALL  G  VL+Y G  DL    +    W+  +EW G   F     + + 
Sbjct: 325  DVMKSVKPEVEALLR-GTRVLLYQGIRDLRDGVVSTEAWMRELEWDGLPAFLDADRAVWR 383

Query: 1470 VDDAQAGVLKSHGALSFLKVHNAGHMVPMDQPKAALEML 1586
            + +  AG ++  G LS + V+ AGH++P D  +AA EM+
Sbjct: 384  IGEELAGYVQRSGPLSHVVVYGAGHLMPADNGRAAQEMI 422
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 135598241 Number of Sequences: 59712 Number of extensions: 4570198 Number of successful extensions: 80166 Number of sequences better than 1.0e-10: 76 Number of HSP's better than 0.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 29 Number of HSP's that attempted gapping in prelim test: 79920 Number of HSP's gapped (non-prelim): 114 length of query: 644 length of database: 26,991,925 effective HSP length: 53 effective length of query: 590 effective length of database: 23,827,189 effective search space: 14058041510 effective search space used: 14058041510 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 161 (67.1 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG602   Members:17             3pri:Y   1e-123      
P31924           Sucrose synthase 2 (Sucrose-UDP glucosyltransferase
2) emb|CAA41774.1| sucrose-UDP glucosyltransferase (isoenz
         (1631 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9631.m02804|protein  sucrose-UDP glucosyltransferase 2          894  0.0
 9635.m04256|protein  Sucrose synthase, putative                 846  0.0
 9634.m00901|protein  sucrose synthase (EC 2.4.1.13) 1 - rice    776  0.0
 9634.m00900|protein  sucrose synthase (EC 2.4.1.13) 1 - rice    776  0.0
 9634.m00899|protein  sucrose synthase (EC 2.4.1.13) 1 - rice    776  0.0
 9634.m00898|protein  sucrose synthase (EC 2.4.1.13) 1 - rice    776  0.0
 9631.m02214|protein  sucrose synthase 3                         674  0.0
 9631.m02215|protein  sucrose synthase 3                         674  0.0
 9630.m05839|protein  Sucrose synthase, putative                 548  e-156
 9632.m01596|protein  Sucrose synthase, putative                 505  e-142
 9632.m02280|protein  Sucrose synthase, putative                 503  e-142
 9629.m06860|protein  glycosyl transferase, group 1 family ...   125  2e-28
 9636.m02033|protein  sucrose-phosphate synthase 1 (ec 2.4....   124  5e-28
 9636.m02032|protein  sucrose-phosphate synthase 1 (ec 2.4....   124  5e-28
 9634.m04216|protein  sucrose-phosphate synthase                 124  5e-28
 9630.m00828|protein  sucrose-phosphate synthase                 123  6e-28
 9630.m00829|protein  sucrose-phosphate synthase                 123  6e-28
 9634.m00988|protein  hypothetical protein                        68  6e-11

  9631.m02804|protein  sucrose-UDP glucosyltransferase 2
            Length = 816
            
 Score =  894 bits (2285), Expect = 0.0
 Identities = 422/440 (95%), Positives = 436/440 (98%)
 Frame = +2

Query: 2    GIVRKWISRFEVWPYLETFTEDVAHEISGELQANPDLIIGNYSDGNLVACLLAHKMGVTH 181
            GIVRKWISRFEVWPYLETFT+DVAHEI+GELQANPDLIIGNYSDGNLVACLLAHKMGVTH
Sbjct: 377  GIVRKWISRFEVWPYLETFTDDVAHEIAGELQANPDLIIGNYSDGNLVACLLAHKMGVTH 436

Query: 182  CTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTTDLIAMNHADFIITSTFQEIAGNKDTV 361
            CTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTTDLIAMNHADFIITSTFQEIAGNKDTV
Sbjct: 437  CTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTTDLIAMNHADFIITSTFQEIAGNKDTV 496

Query: 362  GQYESHMAFTMPGMYRVVHGIDVFDPKFNIVSPGADMSIYFPYSESQRRLTSLHPEIEEL 541
            GQYESHMAFTMPG+YRVVHGIDVFDPKFNIVSPGADMSIYFPYSES++RLTSLHPEIEEL
Sbjct: 497  GQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPYSESRKRLTSLHPEIEEL 556

Query: 542  LYSNVDNNEHKYVLKDRNKPIIFSMARLDRVKNLTGLVELYGKNPRLQELVNLVVVCGDH 721
            LYS VDNNEHK++LKDRNKPIIFSMARLDRVKNLTGLVELYG+NPRLQELVNLVVVCGDH
Sbjct: 557  LYSEVDNNEHKFMLKDRNKPIIFSMARLDRVKNLTGLVELYGRNPRLQELVNLVVVCGDH 616

Query: 722  GNPSKDKEEQAEFKKMFDLIEQYNLNGHVRWISAQMNRVRNAELYRYICDTKGAFVQPAF 901
            GNPSKDKEEQAEFKKMFDLIEQYNLNGH+RWISAQMNRVRN ELYRYICDTKGAFVQPAF
Sbjct: 617  GNPSKDKEEQAEFKKMFDLIEQYNLNGHIRWISAQMNRVRNGELYRYICDTKGAFVQPAF 676

Query: 902  YEAFGLTVIEAMTCGLPTFATAYGGPAEIIVNGVSGYHIDPYQGDKASALLVEFFEKCEV 1081
            YEAFGLTV+E+MTCGLPTFATAYGGPAEIIVNGVSG+HIDPYQGDKASALLVEFFEKC+ 
Sbjct: 677  YEAFGLTVVESMTCGLPTFATAYGGPAEIIVNGVSGFHIDPYQGDKASALLVEFFEKCQE 736

Query: 1082 DPSHWTKISQGGLQRIEEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYLEMLYAL 1261
            DPSHWTKISQGGLQRIEEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYLEMLYAL
Sbjct: 737  DPSHWTKISQGGLQRIEEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYLEMLYAL 796

Query: 1262 KYRTMASTVPLAVEGESSSK 1321
            KYRTMASTVPLAVEGE S+K
Sbjct: 797  KYRTMASTVPLAVEGEPSNK 816
  9635.m04256|protein  Sucrose synthase, putative
            Length = 816
            
 Score =  846 bits (2161), Expect = 0.0
 Identities = 397/440 (90%), Positives = 424/440 (96%)
 Frame = +2

Query: 2    GIVRKWISRFEVWPYLETFTEDVAHEISGELQANPDLIIGNYSDGNLVACLLAHKMGVTH 181
            G VRKWISRFEVWPYLET+T+DVAHEISGELQA PDLIIGNYSDGNLVACLLAHK+GVTH
Sbjct: 377  GTVRKWISRFEVWPYLETYTDDVAHEISGELQATPDLIIGNYSDGNLVACLLAHKLGVTH 436

Query: 182  CTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTTDLIAMNHADFIITSTFQEIAGNKDTV 361
            CTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFT DLIAMNHADFIITSTFQEIAGNK+TV
Sbjct: 437  CTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTADLIAMNHADFIITSTFQEIAGNKETV 496

Query: 362  GQYESHMAFTMPGMYRVVHGIDVFDPKFNIVSPGADMSIYFPYSESQRRLTSLHPEIEEL 541
            GQYESHMAFTMPG+YRVVHGIDVFDPKFNIVSPGADMSIYFP++ESQ+RLTSLH EIEEL
Sbjct: 497  GQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPFTESQKRLTSLHLEIEEL 556

Query: 542  LYSNVDNNEHKYVLKDRNKPIIFSMARLDRVKNLTGLVELYGKNPRLQELVNLVVVCGDH 721
            L+S+V+N EHK+VLKD+ KPIIFSMARLD VKNLTGLVELYG+NPRLQELVNLVVVCGDH
Sbjct: 557  LFSDVENTEHKFVLKDKKKPIIFSMARLDHVKNLTGLVELYGRNPRLQELVNLVVVCGDH 616

Query: 722  GNPSKDKEEQAEFKKMFDLIEQYNLNGHVRWISAQMNRVRNAELYRYICDTKGAFVQPAF 901
            G  SKDKEEQAEFKKMF+LIEQYNLNGH+RWISAQMNRVRN ELYRYICD +GAFVQPA 
Sbjct: 617  GKESKDKEEQAEFKKMFNLIEQYNLNGHIRWISAQMNRVRNGELYRYICDMRGAFVQPAL 676

Query: 902  YEAFGLTVIEAMTCGLPTFATAYGGPAEIIVNGVSGYHIDPYQGDKASALLVEFFEKCEV 1081
            YEAFGLTVIEAMTCGLPTFATAYGGPAEIIV+GVSGYHIDPYQ DKASALLVEFFEKC+ 
Sbjct: 677  YEAFGLTVIEAMTCGLPTFATAYGGPAEIIVHGVSGYHIDPYQNDKASALLVEFFEKCQE 736

Query: 1082 DPSHWTKISQGGLQRIEEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYLEMLYAL 1261
            DP+HW KISQGGLQRIEEKYTWKLYSERLMTL+GVYGFWKYV+NL+RRETRRYLEMLYAL
Sbjct: 737  DPNHWIKISQGGLQRIEEKYTWKLYSERLMTLSGVYGFWKYVTNLDRRETRRYLEMLYAL 796

Query: 1262 KYRTMASTVPLAVEGESSSK 1321
            KYR MA+TVPLA+EGE+S+K
Sbjct: 797  KYRKMATTVPLAIEGEASTK 816
  9634.m00901|protein  sucrose synthase (EC 2.4.1.13) 1 - rice
            Length = 808
            
 Score =  776 bits (1981), Expect = 0.0
 Identities = 360/440 (81%), Positives = 403/440 (90%)
 Frame = +2

Query: 2    GIVRKWISRFEVWPYLETFTEDVAHEISGELQANPDLIIGNYSDGNLVACLLAHKMGVTH 181
            GI+RKWISRF+VWP+LET+TEDVA+EI  E+QA PDLIIGNYSDGNLVA LLAHK+GVT 
Sbjct: 369  GILRKWISRFDVWPFLETYTEDVANEIMREMQAKPDLIIGNYSDGNLVATLLAHKLGVTQ 428

Query: 182  CTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTTDLIAMNHADFIITSTFQEIAGNKDTV 361
            CTIAHALEKTKYPNSD+Y  KF+  YHFSCQFT DLIAMNH DFIITSTFQEIAG+KDTV
Sbjct: 429  CTIAHALEKTKYPNSDIYLDKFDSQYHFSCQFTADLIAMNHTDFIITSTFQEIAGSKDTV 488

Query: 362  GQYESHMAFTMPGMYRVVHGIDVFDPKFNIVSPGADMSIYFPYSESQRRLTSLHPEIEEL 541
            GQYESH+AFT+PG+YRVVHGIDVFDPKFNIVSPGADMS+YFPY+E+ +RLT+ HPEIEEL
Sbjct: 489  GQYESHIAFTLPGLYRVVHGIDVFDPKFNIVSPGADMSVYFPYTEADKRLTAFHPEIEEL 548

Query: 542  LYSNVDNNEHKYVLKDRNKPIIFSMARLDRVKNLTGLVELYGKNPRLQELVNLVVVCGDH 721
            LYS V+N+EHK+VLKD+NKPIIFSMARLDRVKN+TGLVE+YGKN  L++L NLV+VCGDH
Sbjct: 549  LYSEVENDEHKFVLKDKNKPIIFSMARLDRVKNMTGLVEMYGKNAHLRDLANLVIVCGDH 608

Query: 722  GNPSKDKEEQAEFKKMFDLIEQYNLNGHVRWISAQMNRVRNAELYRYICDTKGAFVQPAF 901
            GN SKD+EEQAEFKKM+ LI+QY L GH+RWISAQMNRVRN ELYRYICDTKG FVQPAF
Sbjct: 609  GNQSKDREEQAEFKKMYGLIDQYKLKGHIRWISAQMNRVRNGELYRYICDTKGVFVQPAF 668

Query: 902  YEAFGLTVIEAMTCGLPTFATAYGGPAEIIVNGVSGYHIDPYQGDKASALLVEFFEKCEV 1081
            YEAFGLTVIEAMTCGLPT AT +GGPAEIIV+GVSG HIDPY  DKA+ +LV FFEKC+ 
Sbjct: 669  YEAFGLTVIEAMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVNFFEKCKQ 728

Query: 1082 DPSHWTKISQGGLQRIEEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYLEMLYAL 1261
            D ++W  ISQGGLQRI EKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRY+EM YAL
Sbjct: 729  DSTYWDNISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYIEMFYAL 788

Query: 1262 KYRTMASTVPLAVEGESSSK 1321
            KYR++AS VPLAV+GES+SK
Sbjct: 789  KYRSLASAVPLAVDGESTSK 808
  9634.m00900|protein  sucrose synthase (EC 2.4.1.13) 1 - rice
            Length = 808
            
 Score =  776 bits (1981), Expect = 0.0
 Identities = 360/440 (81%), Positives = 403/440 (90%)
 Frame = +2

Query: 2    GIVRKWISRFEVWPYLETFTEDVAHEISGELQANPDLIIGNYSDGNLVACLLAHKMGVTH 181
            GI+RKWISRF+VWP+LET+TEDVA+EI  E+QA PDLIIGNYSDGNLVA LLAHK+GVT 
Sbjct: 369  GILRKWISRFDVWPFLETYTEDVANEIMREMQAKPDLIIGNYSDGNLVATLLAHKLGVTQ 428

Query: 182  CTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTTDLIAMNHADFIITSTFQEIAGNKDTV 361
            CTIAHALEKTKYPNSD+Y  KF+  YHFSCQFT DLIAMNH DFIITSTFQEIAG+KDTV
Sbjct: 429  CTIAHALEKTKYPNSDIYLDKFDSQYHFSCQFTADLIAMNHTDFIITSTFQEIAGSKDTV 488

Query: 362  GQYESHMAFTMPGMYRVVHGIDVFDPKFNIVSPGADMSIYFPYSESQRRLTSLHPEIEEL 541
            GQYESH+AFT+PG+YRVVHGIDVFDPKFNIVSPGADMS+YFPY+E+ +RLT+ HPEIEEL
Sbjct: 489  GQYESHIAFTLPGLYRVVHGIDVFDPKFNIVSPGADMSVYFPYTEADKRLTAFHPEIEEL 548

Query: 542  LYSNVDNNEHKYVLKDRNKPIIFSMARLDRVKNLTGLVELYGKNPRLQELVNLVVVCGDH 721
            LYS V+N+EHK+VLKD+NKPIIFSMARLDRVKN+TGLVE+YGKN  L++L NLV+VCGDH
Sbjct: 549  LYSEVENDEHKFVLKDKNKPIIFSMARLDRVKNMTGLVEMYGKNAHLRDLANLVIVCGDH 608

Query: 722  GNPSKDKEEQAEFKKMFDLIEQYNLNGHVRWISAQMNRVRNAELYRYICDTKGAFVQPAF 901
            GN SKD+EEQAEFKKM+ LI+QY L GH+RWISAQMNRVRN ELYRYICDTKG FVQPAF
Sbjct: 609  GNQSKDREEQAEFKKMYGLIDQYKLKGHIRWISAQMNRVRNGELYRYICDTKGVFVQPAF 668

Query: 902  YEAFGLTVIEAMTCGLPTFATAYGGPAEIIVNGVSGYHIDPYQGDKASALLVEFFEKCEV 1081
            YEAFGLTVIEAMTCGLPT AT +GGPAEIIV+GVSG HIDPY  DKA+ +LV FFEKC+ 
Sbjct: 669  YEAFGLTVIEAMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVNFFEKCKQ 728

Query: 1082 DPSHWTKISQGGLQRIEEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYLEMLYAL 1261
            D ++W  ISQGGLQRI EKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRY+EM YAL
Sbjct: 729  DSTYWDNISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYIEMFYAL 788

Query: 1262 KYRTMASTVPLAVEGESSSK 1321
            KYR++AS VPLAV+GES+SK
Sbjct: 789  KYRSLASAVPLAVDGESTSK 808
  9634.m00899|protein  sucrose synthase (EC 2.4.1.13) 1 - rice
            Length = 808
            
 Score =  776 bits (1981), Expect = 0.0
 Identities = 360/440 (81%), Positives = 403/440 (90%)
 Frame = +2

Query: 2    GIVRKWISRFEVWPYLETFTEDVAHEISGELQANPDLIIGNYSDGNLVACLLAHKMGVTH 181
            GI+RKWISRF+VWP+LET+TEDVA+EI  E+QA PDLIIGNYSDGNLVA LLAHK+GVT 
Sbjct: 369  GILRKWISRFDVWPFLETYTEDVANEIMREMQAKPDLIIGNYSDGNLVATLLAHKLGVTQ 428

Query: 182  CTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTTDLIAMNHADFIITSTFQEIAGNKDTV 361
            CTIAHALEKTKYPNSD+Y  KF+  YHFSCQFT DLIAMNH DFIITSTFQEIAG+KDTV
Sbjct: 429  CTIAHALEKTKYPNSDIYLDKFDSQYHFSCQFTADLIAMNHTDFIITSTFQEIAGSKDTV 488

Query: 362  GQYESHMAFTMPGMYRVVHGIDVFDPKFNIVSPGADMSIYFPYSESQRRLTSLHPEIEEL 541
            GQYESH+AFT+PG+YRVVHGIDVFDPKFNIVSPGADMS+YFPY+E+ +RLT+ HPEIEEL
Sbjct: 489  GQYESHIAFTLPGLYRVVHGIDVFDPKFNIVSPGADMSVYFPYTEADKRLTAFHPEIEEL 548

Query: 542  LYSNVDNNEHKYVLKDRNKPIIFSMARLDRVKNLTGLVELYGKNPRLQELVNLVVVCGDH 721
            LYS V+N+EHK+VLKD+NKPIIFSMARLDRVKN+TGLVE+YGKN  L++L NLV+VCGDH
Sbjct: 549  LYSEVENDEHKFVLKDKNKPIIFSMARLDRVKNMTGLVEMYGKNAHLRDLANLVIVCGDH 608

Query: 722  GNPSKDKEEQAEFKKMFDLIEQYNLNGHVRWISAQMNRVRNAELYRYICDTKGAFVQPAF 901
            GN SKD+EEQAEFKKM+ LI+QY L GH+RWISAQMNRVRN ELYRYICDTKG FVQPAF
Sbjct: 609  GNQSKDREEQAEFKKMYGLIDQYKLKGHIRWISAQMNRVRNGELYRYICDTKGVFVQPAF 668

Query: 902  YEAFGLTVIEAMTCGLPTFATAYGGPAEIIVNGVSGYHIDPYQGDKASALLVEFFEKCEV 1081
            YEAFGLTVIEAMTCGLPT AT +GGPAEIIV+GVSG HIDPY  DKA+ +LV FFEKC+ 
Sbjct: 669  YEAFGLTVIEAMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVNFFEKCKQ 728

Query: 1082 DPSHWTKISQGGLQRIEEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYLEMLYAL 1261
            D ++W  ISQGGLQRI EKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRY+EM YAL
Sbjct: 729  DSTYWDNISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYIEMFYAL 788

Query: 1262 KYRTMASTVPLAVEGESSSK 1321
            KYR++AS VPLAV+GES+SK
Sbjct: 789  KYRSLASAVPLAVDGESTSK 808
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103421791 Number of Sequences: 59712 Number of extensions: 2810839 Number of successful extensions: 11089 Number of sequences better than 1.0e-10: 36 Number of HSP's better than 0.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 11041 Number of HSP's gapped (non-prelim): 30 length of query: 543 length of database: 26,991,925 effective HSP length: 52 effective length of query: 491 effective length of database: 23,886,901 effective search space: 11728468391 effective search space used: 11728468391 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG610   Members:8              3pri:Y   1e-97       
P40880           Carbonic anhydrase, chloroplast precursor (Carbonate
dehydratase) pir||T04478 probable carbonate dehydratase (
         (906 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9629.m04324|protein  Carbonic anhydrase, putative               339  6e-93
 9629.m04323|protein  Carbonic anhydrase, putative               335  5e-92
 9637.m02550|protein  carbonate dehydratase, putative            167  2e-41
 9637.m02548|protein  carbonate dehydratase, putative            167  2e-41
 9637.m02549|protein  carbonate dehydratase, putative            167  2e-41
 9637.m02551|protein  carbonate dehydratase, putative            104  3e-22
 9629.m04325|protein  retrotransposon protein, putative, un...    87  4e-17

  9629.m04324|protein  Carbonic anhydrase, putative
           Length = 262
           
 Score =  339 bits (859), Expect = 6e-93
 Identities = 162/204 (79%), Positives = 177/204 (86%), Gaps = 4/204 (1%)
 Frame = +2

Query: 20  NHPCRLKME----RLRTGFDKFKTEVYDKKPDLFGPLKANQEPTYLLFACADSRVCPSVT 187
           NHP   KM+    RL+ GF KFKTE YDKKP+LF PLKA Q P Y++F+CADSRVCPSVT
Sbjct: 54  NHPPPSKMDAAVDRLKDGFAKFKTEFYDKKPELFEPLKAGQAPKYMVFSCADSRVCPSVT 113

Query: 188 LGLEPGEAFTVRNIGAMVPCYCKNKHTGVGSAIEYAVCALKVKVIVVIGHSRCGGIKALL 367
           +GLEPGEAFTVRNI  MVP YCK KH GVGSAIEYAVCALKV++IVVIGHSRCGGIKALL
Sbjct: 114 MGLEPGEAFTVRNIANMVPAYCKIKHAGVGSAIEYAVCALKVELIVVIGHSRCGGIKALL 173

Query: 368 SLKDGADDSFHFVEDWVRIGFSAKKKVKDECCDLPFEDQCAVLEKEAVNVSLQNLSTYPF 547
           SLKDGA DSFHFVEDWVR GF AKKKV+ E   LPF+DQCA+LEKEAVN SL+NL TYPF
Sbjct: 174 SLKDGAPDSFHFVEDWVRTGFPAKKKVQTEHASLPFDDQCAILEKEAVNQSLENLKTYPF 233

Query: 548 VKEGVANGTLKLIGGHYDFVSGKFDTWE 631
           VKEG+ANGTLKL+GGHYDFVSG  D WE
Sbjct: 234 VKEGIANGTLKLVGGHYDFVSGNLDLWE 261
  9629.m04323|protein  Carbonic anhydrase, putative
           Length = 272
           
 Score =  335 bits (851), Expect = 5e-92
 Identities = 157/197 (79%), Positives = 173/197 (87%)
 Frame = +2

Query: 41  MERLRTGFDKFKTEVYDKKPDLFGPLKANQEPTYLLFACADSRVCPSVTLGLEPGEAFTV 220
           ++RL+ GF KFKTE YDKKP+LF PLKA Q P Y++F+CADSRVCPSVT+GLEPGEAFTV
Sbjct: 75  VDRLKDGFAKFKTEFYDKKPELFEPLKAGQAPKYMVFSCADSRVCPSVTMGLEPGEAFTV 134

Query: 221 RNIGAMVPCYCKNKHTGVGSAIEYAVCALKVKVIVVIGHSRCGGIKALLSLKDGADDSFH 400
           RNI  MVP YCK KH GVGSAIEYAVCALKV++IVVIGHSRCGGIKALLSLKDGA DSFH
Sbjct: 135 RNIANMVPAYCKIKHAGVGSAIEYAVCALKVELIVVIGHSRCGGIKALLSLKDGAPDSFH 194

Query: 401 FVEDWVRIGFSAKKKVKDECCDLPFEDQCAVLEKEAVNVSLQNLSTYPFVKEGVANGTLK 580
           FVEDWVR GF AKKKV+ E   LPF+DQCA+LEKEAVN SL+NL TYPFVKEG+ANGTLK
Sbjct: 195 FVEDWVRTGFPAKKKVQTEHASLPFDDQCAILEKEAVNQSLENLKTYPFVKEGIANGTLK 254

Query: 581 LIGGHYDFVSGKFDTWE 631
           L+GGHYDFVSG  D WE
Sbjct: 255 LVGGHYDFVSGNLDLWE 271
  9637.m02550|protein  carbonate dehydratase, putative
           Length = 333
           
 Score =  167 bits (419), Expect = 2e-41
 Identities = 85/173 (49%), Positives = 119/173 (68%), Gaps = 2/173 (1%)
 Frame = +2

Query: 116 LKANQEPTYLLFACADSRVCPSVTLGLEPGEAFTVRNIGAMVPCYCKNKHTGVGSAIEYA 295
           L   Q P +++ ACADSRVCPS  LG +PGEAFTVRNI  +VP Y ++  +   +A+E+A
Sbjct: 139 LAQQQTPKFMVVACADSRVCPSSVLGFQPGEAFTVRNIANLVPPY-QHGASETSAALEFA 197

Query: 296 VCALKVKVIVVIGHSRCGGIKALLSLKDGADDSFH--FVEDWVRIGFSAKKKVKDECCDL 469
           V  L+V+ ++V+GHSRCGGI+AL+S+K   DDS    F+ DWV I  SA+   +    +L
Sbjct: 198 VNTLEVENVLVVGHSRCGGIQALMSMKSKQDDSQSRSFIRDWVSIAKSARLSTEAAAGNL 257

Query: 470 PFEDQCAVLEKEAVNVSLQNLSTYPFVKEGVANGTLKLIGGHYDFVSGKFDTWEL 634
            FE QC   EKE++N SL NL TYP++++ V  GTL L GG+Y+F+   F+ W+L
Sbjct: 258 NFELQCKHCEKESINSSLLNLLTYPWIEKRVNEGTLSLHGGYYNFIDCTFEKWKL 312
  9637.m02548|protein  carbonate dehydratase, putative
           Length = 250
           
 Score =  167 bits (419), Expect = 2e-41
 Identities = 85/173 (49%), Positives = 119/173 (68%), Gaps = 2/173 (1%)
 Frame = +2

Query: 116 LKANQEPTYLLFACADSRVCPSVTLGLEPGEAFTVRNIGAMVPCYCKNKHTGVGSAIEYA 295
           L   Q P +++ ACADSRVCPS  LG +PGEAFTVRNI  +VP Y ++  +   +A+E+A
Sbjct: 56  LAQQQTPKFMVVACADSRVCPSSVLGFQPGEAFTVRNIANLVPPY-QHGASETSAALEFA 114

Query: 296 VCALKVKVIVVIGHSRCGGIKALLSLKDGADDSFH--FVEDWVRIGFSAKKKVKDECCDL 469
           V  L+V+ ++V+GHSRCGGI+AL+S+K   DDS    F+ DWV I  SA+   +    +L
Sbjct: 115 VNTLEVENVLVVGHSRCGGIQALMSMKSKQDDSQSRSFIRDWVSIAKSARLSTEAAAGNL 174

Query: 470 PFEDQCAVLEKEAVNVSLQNLSTYPFVKEGVANGTLKLIGGHYDFVSGKFDTWEL 634
            FE QC   EKE++N SL NL TYP++++ V  GTL L GG+Y+F+   F+ W+L
Sbjct: 175 NFELQCKHCEKESINSSLLNLLTYPWIEKRVNEGTLSLHGGYYNFIDCTFEKWKL 229
  9637.m02549|protein  carbonate dehydratase, putative
           Length = 306
           
 Score =  167 bits (419), Expect = 2e-41
 Identities = 85/173 (49%), Positives = 119/173 (68%), Gaps = 2/173 (1%)
 Frame = +2

Query: 116 LKANQEPTYLLFACADSRVCPSVTLGLEPGEAFTVRNIGAMVPCYCKNKHTGVGSAIEYA 295
           L   Q P +++ ACADSRVCPS  LG +PGEAFTVRNI  +VP Y ++  +   +A+E+A
Sbjct: 112 LAQQQTPKFMVVACADSRVCPSSVLGFQPGEAFTVRNIANLVPPY-QHGASETSAALEFA 170

Query: 296 VCALKVKVIVVIGHSRCGGIKALLSLKDGADDSFH--FVEDWVRIGFSAKKKVKDECCDL 469
           V  L+V+ ++V+GHSRCGGI+AL+S+K   DDS    F+ DWV I  SA+   +    +L
Sbjct: 171 VNTLEVENVLVVGHSRCGGIQALMSMKSKQDDSQSRSFIRDWVSIAKSARLSTEAAAGNL 230

Query: 470 PFEDQCAVLEKEAVNVSLQNLSTYPFVKEGVANGTLKLIGGHYDFVSGKFDTWEL 634
            FE QC   EKE++N SL NL TYP++++ V  GTL L GG+Y+F+   F+ W+L
Sbjct: 231 NFELQCKHCEKESINSSLLNLLTYPWIEKRVNEGTLSLHGGYYNFIDCTFEKWKL 285
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58799892 Number of Sequences: 59712 Number of extensions: 1705439 Number of successful extensions: 7700 Number of sequences better than 1.0e-10: 14 Number of HSP's better than 0.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7684 Number of HSP's gapped (non-prelim): 9 length of query: 302 length of database: 26,991,925 effective HSP length: 51 effective length of query: 250 effective length of database: 23,946,613 effective search space: 5986653250 effective search space used: 5986653250 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG614   Members:412            3pri:Y   1e-116      
P27665           Oxygen-evolving enhancer protein 1, chloroplast
precursor (OEE1) (33 kDa subunit of oxygen evolving system of
         (1319 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9629.m02949|protein  Manganese-stabilizing protein / photo...   599  e-171
 9629.m02950|protein  Manganese-stabilizing protein / photo...   484  e-136
 9639.m04036|protein  transposon protein, putative, CACTA, ...    71  4e-12
 9631.m03557|protein  putative protein kinase                     69  1e-11
 9633.m03752|protein  retrotransposon protein, putative, un...    69  2e-11

  9629.m02949|protein  Manganese-stabilizing protein / photosystem II
            polypeptide
            Length = 333
            
 Score =  599 bits (1527), Expect = e-171
 Identities = 303/326 (92%), Positives = 314/326 (95%), Gaps = 7/326 (2%)
 Frame = +2

Query: 62   MAASLQAAATLM-PAKIGGRASSV----RPSSHVARAFGVD--AAARITCSLQSDIREVA 220
            MAASLQAAATLM PAK+GGRASS     RPSSHVARAFGVD  AA RITCSLQSDIREVA
Sbjct: 1    MAASLQAAATLMQPAKLGGRASSAALPSRPSSHVARAFGVDTGAAGRITCSLQSDIREVA 60

Query: 221  SKCADAAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDG 400
            +KCADAAK+AGFALATSALLVSGASAEG P+RLTFDEIQSKTYMEVKGTGTANQCPT++G
Sbjct: 61   NKCADAAKLAGFALATSALLVSGASAEGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEG 120

Query: 401  GVDSFPFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLE 580
            GVDSF FKAGKY MKKFCLEPTSFTVKAEG+ KN PP FQKTKLMTRLTYTLDE+EGPLE
Sbjct: 121  GVDSFAFKAGKYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLE 180

Query: 581  VGADGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGPFLVPSYRGS 760
            V +DGT+KFEEKDGIDYAAVTVQLPGGERVPFLFT+K LVATGKPESF GPFLVPSYRGS
Sbjct: 181  VSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKNLVATGKPESFGGPFLVPSYRGS 240

Query: 761  SFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEV 940
            SFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEV
Sbjct: 241  SFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEV 300

Query: 941  IGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE 1039
            IGVFESVQPSDTDLGAK PKDVKIQGVWYAQLE
Sbjct: 301  IGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE 333
  9629.m02950|protein  Manganese-stabilizing protein / photosystem II
            polypeptide
            Length = 274
            
 Score =  484 bits (1233), Expect = e-136
 Identities = 239/276 (86%), Positives = 250/276 (89%)
 Frame = +2

Query: 212  EVASKCADAAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPT 391
            + A+     AK+ G A        SGASAEG P+RLTFDEIQSKTYMEVKGTGTANQCPT
Sbjct: 6    QAAATLMQPAKLGGRAS-------SGASAEGVPRRLTFDEIQSKTYMEVKGTGTANQCPT 58

Query: 392  IDGGVDSFPFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEG 571
            ++GGVDSF FKAGKY MKKFCLEPTSFTVKAEG+ KN PP FQKTKLMTRLTYTLDE+EG
Sbjct: 59   VEGGVDSFAFKAGKYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEG 118

Query: 572  PLEVGADGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGPFLVPSY 751
            PLEV +DGT+KFEEKDGIDYAAVTVQLPGGERVPFLFT+K LVATGKPESF GPFLVPSY
Sbjct: 119  PLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKNLVATGKPESFGGPFLVPSY 178

Query: 752  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPET 931
            RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPET
Sbjct: 179  RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPET 238

Query: 932  GEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE 1039
            GEVIGVFESVQPSDTDLGAK PKDVKIQGVWYAQLE
Sbjct: 239  GEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE 274
  9639.m04036|protein  transposon protein, putative, CACTA, En/Spm
            sub-class
            Length = 946
            
 Score = 71.0 bits (171), Expect = 4e-12
 Identities = 80/298 (26%), Positives = 111/298 (36%), Gaps = 11/298 (3%)
 Frame = +3

Query: 36   PAYQAHRPTWQRLSKPRPR*-CRPRSAAG-PPPCGRRRTSPGRSASTLPPGSRAPCNPTS 209
            PA + H P+    + P  +    P S A  PPP      +P    ST PP  ++P  P  
Sbjct: 631  PAPEGHTPSPPESTPPSEKSPLTPESKASCPPPPTPEGHTPSPPKST-PPTEKSPHTP-- 687

Query: 210  GRSQASAPTPPRWPASPSQPLPSSSLAQVRRGRPRG*PSTKSRARPTWR*RVPAPRTSAR 389
              S++S+P PP        P P  S   V +  P       S   P      P+P  S+ 
Sbjct: 688  -ESESSSPPPPA--PEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEGHTPSPPKSSP 744

Query: 390  PSTAASTPSPSRPASTR*RSSAWSPPPSPSRPRASRRTSHRPSRRPSS--*PVSLTPLTR 563
            P   +    P+   S          PP  S P       H P + P S   P S  P  +
Sbjct: 745  PEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSPPSEAHPTSPPPSEK 804

Query: 564  ---WKARSRSAPT---APSSSRRRTASTTRPSQCSSPEASACRSS-SPSSSSSPPASRRA 722
                 A   S PT   +PS       +   P + SSP   A  SS  P  SSSPP     
Sbjct: 805  SPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHV 864

Query: 723  SAGPSSCPATGVPLSSTQRAVVALLATTTRWRCPPEAEETRRSWPRRT*RTRPPPRATSP 902
            S+ P    +   P + +   +   ++     + PP       S P +   + PPP  T  
Sbjct: 865  SSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSK--ESEPPPTPTPK 922

Query: 903  SA*PRASRR 929
            S+ P    R
Sbjct: 923  SSPPSHEER 931
 Score = 69.9 bits (168), Expect = 1e-11
 Identities = 88/303 (29%), Positives = 124/303 (40%), Gaps = 32/303 (10%)
 Frame = +3

Query: 81   PRPR*CRPRSAAGPPPCGRRRTSPGRSASTLPPGS---RAPCNPTSGRSQASAPTPPRWP 251
            P P    P      PP  +   +P   AS+ PP +     P  P S      +P  P   
Sbjct: 598  PTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPLTPESK 657

Query: 252  AS-PSQPLPSSSLAQVRRGRPRG*PSTKSRARPTWR*RVPAPRT--SARPSTAASTPSPS 422
            AS P  P P        +  P   P+ KS   P      P P       PS   STP   
Sbjct: 658  ASCPPPPTPEGHTPSPPKSTP---PTEKSPHTPESESSSPPPPAPEGHMPSPPKSTPPVE 714

Query: 423  RPASTR*RSSAWSPPP------SPSRPRASRRTSHRPSRRPSS*PVSLTPLTRWKARSRS 584
            +   T   S A SPPP      +PS P++S      P   P+S     TP     +  +S
Sbjct: 715  KSPPTP-ESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKS 773

Query: 585  APTAPSSSRRRTASTTRPSQC--SSPEASACRSSSPSSSSSPPASRRASAGPSSCPAT-G 755
            +P    S    +   + PS+   +SP  S     +P+  SSPP   ++ + PS    T  
Sbjct: 774  SPPEEKSPPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPP 833

Query: 756  VPLSSTQRAVVALLATTTRWRC---PPEAEET-------------RRSWPRRT*RTRPPP 887
             P+ S+     A +++    +    PPEA  +              +S P  T    PPP
Sbjct: 834  SPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPP 893

Query: 888  RATS-PSA*PRASRRPAR**ASSRACSRQTPTSAP 989
               S PS  P +S  P++    S      TP S+P
Sbjct: 894  EGKSPPSHTPESSSPPSK---ESEPPPTPTPKSSP 925
 Score = 67.5 bits (162), Expect = 5e-11
 Identities = 86/308 (27%), Positives = 113/308 (35%), Gaps = 29/308 (9%)
 Frame = +3

Query: 102  PRSAAGPPPCGRRRTS---PGRSASTLPPGSRAPCNPTSGRS-----QASAPTPPRW--P 251
            P     PPP     T    P    S+ PP  ++P  PT+  S     +   P+PP+   P
Sbjct: 523  PERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPVPEGHTPSPPKSGPP 582

Query: 252  ASPSQPLPSSSLAQVRRGRPRG*PSTKSRARPTWR*RVPAPRTSARPSTAASTPSPSRPA 431
            A  S P P S                K+   PT     P+P  S  P    S P+P   A
Sbjct: 583  AGESPPTPES----------------KASPPPTPEEYTPSPPKST-PPAEKSPPTPESKA 625

Query: 432  STR*RSSAWSPPPSPSRPRASRRTSHRPSRRPSS*PVSLTPLTRWKARSRSAPTAPSSSR 611
            S+        PPP+P          H PS   S+ P   +PLT     S   P  P    
Sbjct: 626  SS-------PPPPAPE--------GHTPSPPESTPPSEKSPLTPESKASCPPPPTPEGHT 670

Query: 612  RRTASTTRP---------SQCSSPE--------ASACRSSSPSSSSSPPASRRASAGPSS 740
                 +T P         S+ SSP          S  +S+ P   S P     AS+ P  
Sbjct: 671  PSPPKSTPPTEKSPHTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPP 730

Query: 741  CPA--TGVPLSSTQRAVVALLATTTRWRCPPEAEETRRSWPRRT*RTRPPPRATSPSA*P 914
             P   T  P  S+     +     T    PP  EE   S P+ +      P   SP   P
Sbjct: 731  APEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSPPPHSPEKSP 790

Query: 915  RASRRPAR**ASSRACSRQTPTSAPRRPRMSRSRVCG 1025
             +   P     S ++       S+P  P  S S   G
Sbjct: 791  PSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSPPSG 827
  9631.m03557|protein  putative protein kinase
           Length = 675
           
 Score = 69.5 bits (167), Expect = 1e-11
 Identities = 69/261 (26%), Positives = 105/261 (39%), Gaps = 1/261 (0%)
 Frame = +3

Query: 126 PCGRRRTSPGRSASTLPPGSRAPCNPTSGRSQASAPTPPRWPASPSQPLPSSSLAQVRRG 305
           P G     P +S+S  P  S  P  PT    Q   P PP  PA+P  P P+S       G
Sbjct: 17  PAGGPPEPPPQSSSASPSPSPPPPPPTPSSPQRPPPPPP--PATPPPPPPASP------G 68

Query: 306 RPRG*PSTKSRARPTWR*RVPAPRTSARPSTAASTPSPSRPASTR*RSSAWSPPPSPSRP 485
           + +  P++ S+  P     V +P  S+ P    + PSP  P+ +        PPPSP   
Sbjct: 69  KNQS-PASPSQDSPP---PVASPSVSSPPPAPTTPPSPPPPSKS-------PPPPSPPPT 117

Query: 486 RASRRTSHR-PSRRPSS*PVSLTPLTRWKARSRSAPTAPSSSRRRTASTTRPSQCSSPEA 662
            +S   SH+ P    +S P S        +   + P+ P +++  ++S+T P+   +   
Sbjct: 118 TSSTPPSHQSPPEEGTSPPPS-------PSSGATTPSPPPNAQSSSSSSTPPAGAGTSPP 170

Query: 663 SACRSSSPSSSSSPPASRRASAGPSSCPATGVPLSSTQRAVVALLATTTRWRCPPEAEET 842
           +     SP +  SPP +   +  P   P    P       + + L T    + PP+A   
Sbjct: 171 APREMPSPGTPPSPPTTLITTQAPPIQPPP--PPGGNSMIMPSSLTTAGTSQSPPDA--- 225

Query: 843 RRSWPRRT*RTRPPPRATSPSA 908
                  T    PPP A S  A
Sbjct: 226 -------TTAGAPPPPAPSVGA 240
  9633.m03752|protein  retrotransposon protein, putative, unclassified
            Length = 796
            
 Score = 68.7 bits (165), Expect = 2e-11
 Identities = 95/319 (29%), Positives = 129/319 (39%), Gaps = 8/319 (2%)
 Frame = +3

Query: 90   R*CRPRSAAGPPPCGRRRTSPGRSASTLPPGSRAPCNPTSGRSQASAPTPPRWPASPSQP 269
            R  R  S   P       +S  R+A      S     PT+   ++S    P+   + S+P
Sbjct: 73   RPARSNSVTRPSIQSTLMSSSNRTAVLNTSISSVSSRPTTPSRRSSTVVAPKQSIAASRP 132

Query: 270  LPSSSLAQVRRGRPRG*PSTKSRARPTWR*RVPAPRTSARPSTAASTPSP--SRPASTR* 443
            +P+ S   V+       PST ++ RP+   R      S   S AA T S   SRP++   
Sbjct: 133  VPARSSTPVKTR-----PSTPTKTRPSTPVRTRQTANSTSDSAAARTTSAQNSRPSTPTS 187

Query: 444  RSSAWSPPPSPSRPRASRRTSHRPSRRPSS*PVSLTPLTRWKARSRSAPTAPSSSRRRTA 623
            RS A     S + P  S         RP +  +S T  +R  A + SA + P SS     
Sbjct: 188  RSRAMPNSSSGAIPAMS---------RPGASTISAT--SRSNASTISATSRPGSSSSNVP 236

Query: 624  STTRPSQCSSPEA-SACRSSSPSSSSSPPASRRASAGPSSCPATG-VPLSSTQRAVVALL 797
              +R +  SS    S  RSSS SS+ +     R  A  SS PA G  P      ++ +L 
Sbjct: 237  GISRATSLSSSTVPSMSRSSSRSSTPT-----RQPAMRSSAPAVGRSPSVGRSSSISSLT 291

Query: 798  ATTTRWRCPPEAEETRRSWPRRT*RTRPPPRATSPSA*PRASRRPAR**ASSRACSRQTP 977
            ++  R    P A   R S P     + P  R +SP   PRA  RP               
Sbjct: 292  SSINR----PAANGGRNSAP----SSAPSSRPSSPGPRPRAPVRPLDIPDFPNETPPNLR 343

Query: 978  TSAPRRP-RMSRSR---VCGTRSSSLT 1046
            T  P RP    RSR     G RS+S T
Sbjct: 344  TKLPERPLSAGRSRPGMALGVRSTSNT 370
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94977523 Number of Sequences: 59712 Number of extensions: 3273328 Number of successful extensions: 43936 Number of sequences better than 1.0e-10: 10 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 43763 Number of HSP's gapped (non-prelim): 32 length of query: 439 length of database: 26,991,925 effective HSP length: 52 effective length of query: 387 effective length of database: 23,886,901 effective search space: 9244230687 effective search space used: 9244230687 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG619   Members:42             3pri:Y   3e-88       
BAA78733.1       ESTs AU058067(E20733), AAU058070(E20873) correspond
to a region of the predicted gene.~Similar to Populus trem
         (1346 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9634.m00630|protein  O-methyltransferase                        476  e-134
 9636.m03925|protein  O-methyltransferase                        289  9e-78
 9636.m03927|protein  O-methyltransferase                        286  5e-77
 9636.m03926|protein  O-methyltransferase                        286  8e-77
 9636.m03928|protein  O-methyltransferase                        279  8e-75
 9636.m00509|protein  O-methyltransferase, putative              153  6e-37
 9639.m04036|protein  transposon protein, putative, CACTA, ...    82  3e-15
 9640.m03456|protein  Similar to extensin-like protein - maize    78  3e-14
 9629.m05120|protein  retrotransposon protein, putative, Ty...    77  8e-14
 9629.m00408|protein  expressed protein                           74  8e-14
 9633.m03752|protein  retrotransposon protein, putative, un...    74  5e-13
 9637.m03072|protein  retrotransposon protein, putative, Ty...    68  4e-11
 9636.m00525|protein  dna-directed rna polymerase ii larges...    67  7e-11
 9632.m03436|protein  transposon protein, putative, CACTA, ...    67  9e-11

  9634.m00630|protein  O-methyltransferase
            Length = 260
            
 Score =  476 bits (1211), Expect = e-134
 Identities = 235/262 (89%), Positives = 245/262 (92%)
 Frame = +2

Query: 353  AADATAAVPKDQAANGSAAASTGGEQVTRHSEVGHKSLLQSDALYQYILETSVYPREHEC 532
            AA A AA   +QA NGS+    GGEQ TRHSEVGHKSLL+SD LYQYILETSVYPREHEC
Sbjct: 4    AASAAAAATTEQA-NGSS----GGEQKTRHSEVGHKSLLKSDDLYQYILETSVYPREHEC 58

Query: 533  MKELREITANHPWNLMTTSADEGQFLNMLLKLIGAKKTMEIGVYTGYSLLATALAIPDDG 712
            MKELRE+TANHPWNLMTTSADEGQFLN+LLKLIGAKKTMEIGVYTGYSLLATALAIPDDG
Sbjct: 59   MKELREVTANHPWNLMTTSADEGQFLNLLLKLIGAKKTMEIGVYTGYSLLATALAIPDDG 118

Query: 713  TILAMDINRENYELGLPCIEKAGVAHKIDFREGPALPVLDALLEDEANHGTFDFVFVDAD 892
            TILAMDINRENYELGLP IEKAGVAHKIDFREGPALPVLD L+E+E NHG+FDFVFVDAD
Sbjct: 119  TILAMDINRENYELGLPSIEKAGVAHKIDFREGPALPVLDQLVEEEGNHGSFDFVFVDAD 178

Query: 893  KDNYLNYHERLMKLVKVGGLLGYDNTLWNGSVVLPADAPMRKYIRYYRDFVLDLNKALAA 1072
            KDNYLNYHERLMKLVKVGGL+GYDNTLWNGSVVLPADAPMRKYIRYYRDFVL+LNKALAA
Sbjct: 179  KDNYLNYHERLMKLVKVGGLVGYDNTLWNGSVVLPADAPMRKYIRYYRDFVLELNKALAA 238

Query: 1073 DQRVEICQLPVGDGITLCRRAK 1138
            D RVEICQLPVGDGITLCRR K
Sbjct: 239  DHRVEICQLPVGDGITLCRRVK 260
  9636.m03925|protein  O-methyltransferase
            Length = 252
            
 Score =  289 bits (731), Expect = 9e-78
 Identities = 138/231 (59%), Positives = 181/231 (77%), Gaps = 5/231 (2%)
 Frame = +2

Query: 440  HSEVG--HKSLLQSDALYQYILETSVYPREHECMKELREITANHPWNLMTTSADEGQFLN 613
            HS++   +K+LL+SDALY+Y+L+T+V PRE ECM++LR IT  H W  M +SADE Q L 
Sbjct: 15   HSDIDSTNKTLLKSDALYKYVLDTTVLPREPECMRDLRLITDKHQWGFMQSSADEAQLLG 74

Query: 614  MLLKLIGAKKTMEIGVYTGYSLLATALAIPDDGTILAMDINRENYELGLPCIEKAGVAHK 793
            MLLK+ GAK+T+E+GV+TGYSLLATALA+P+DG ++A+D +RE+YE+G P +EKAGVAHK
Sbjct: 75   MLLKMAGAKRTIEVGVFTGYSLLATALALPEDGKVVAIDPDRESYEIGRPFLEKAGVAHK 134

Query: 794  IDFREGPALPVLDALLEDEANHG---TFDFVFVDADKDNYLNYHERLMKLVKVGGLLGYD 964
            +DFREG  L  LD LL +EA  G    FDF FVDADK NY+ YHE+L++LV+VGG + YD
Sbjct: 135  VDFREGKGLEKLDELLAEEAAAGREAAFDFAFVDADKPNYVKYHEQLLQLVRVGGHIVYD 194

Query: 965  NTLWNGSVVLPADAPMRKYIRYYRDFVLDLNKALAADQRVEICQLPVGDGITLCRR 1132
            NTLW G+V LP D P+    R +   + DLN  LAAD R+++CQL + DGIT+CRR
Sbjct: 195  NTLWAGTVALPPDTPLSDLDRRFSVAIRDLNSRLAADPRIDVCQLAIADGITICRR 250
  9636.m03927|protein  O-methyltransferase
            Length = 292
            
 Score =  286 bits (725), Expect = 5e-77
 Identities = 142/267 (53%), Positives = 190/267 (70%), Gaps = 1/267 (0%)
 Frame = +2

Query: 332  TPAM-ATTAADATAAVPKDQAANGSAAASTGGEQVTRHSEVGHKSLLQSDALYQYILETS 508
            TPA   ++ A A A       ANG     +   +   HS    K+LL+S++L++Y+L T 
Sbjct: 23   TPASRVSSTAMAAANGDASHGANGGIQIQSKEMKTAIHSNDSPKTLLKSESLHEYMLNTM 82

Query: 509  VYPREHECMKELREITANHPWNLMTTSADEGQFLNMLLKLIGAKKTMEIGVYTGYSLLAT 688
            VYPRE+E M+ELR IT+ H +  M++  +EGQ L++LL L GAK T+E+GV+TG S+LAT
Sbjct: 83   VYPRENEFMRELRLITSEHTYGFMSSPPEEGQLLSLLLNLTGAKNTIEVGVFTGCSVLAT 142

Query: 689  ALAIPDDGTILAMDINRENYELGLPCIEKAGVAHKIDFREGPALPVLDALLEDEANHGTF 868
            ALAIPDDG ++A+D++RE ++LGLP I+KAGVAHK+DFREG A+P+LD LL +E N G F
Sbjct: 143  ALAIPDDGKVVAIDVSREYFDLGLPVIKKAGVAHKVDFREGAAMPILDNLLANEENEGKF 202

Query: 869  DFVFVDADKDNYLNYHERLMKLVKVGGLLGYDNTLWNGSVVLPADAPMRKYIRYYRDFVL 1048
            DF FVDADK NY  YHERL++LV+ GG+L YDNTLW GSV L  D+ + ++ +  R  ++
Sbjct: 203  DFAFVDADKGNYGEYHERLLRLVRAGGVLAYDNTLWGGSVALEDDSVLEEFDQDIRRSIV 262

Query: 1049 DLNKALAADQRVEICQLPVGDGITLCRR 1132
              N  +A D RVE  QLPV DGITLCRR
Sbjct: 263  AFNAKIAGDPRVEAVQLPVSDGITLCRR 290
  9636.m03926|protein  O-methyltransferase
            Length = 260
            
 Score =  286 bits (723), Expect = 8e-77
 Identities = 141/248 (56%), Positives = 188/248 (74%), Gaps = 8/248 (3%)
 Frame = +2

Query: 389  AANGSAA-ASTGGEQVTR-------HSEVGHKSLLQSDALYQYILETSVYPREHECMKEL 544
            AANG A+  + GG Q+         HS    K+LL+S++L++Y+L T VYPRE+E M+EL
Sbjct: 3    AANGDASHGANGGIQIQSKEMKTAIHSNDSPKTLLKSESLHEYMLNTMVYPRENEFMREL 62

Query: 545  REITANHPWNLMTTSADEGQFLNMLLKLIGAKKTMEIGVYTGYSLLATALAIPDDGTILA 724
            R IT+ H +  M++  +EGQ L++LL L GAK T+E+GV+TG S+LATALAIPDDG ++A
Sbjct: 63   RLITSEHTYGFMSSPPEEGQLLSLLLNLTGAKNTIEVGVFTGCSVLATALAIPDDGKVVA 122

Query: 725  MDINRENYELGLPCIEKAGVAHKIDFREGPALPVLDALLEDEANHGTFDFVFVDADKDNY 904
            +D++RE ++LGLP I+KAGVAHK+DFREG A+P+LD LL +E N G FDF FVDADK NY
Sbjct: 123  IDVSREYFDLGLPVIKKAGVAHKVDFREGAAMPILDNLLANEENEGKFDFAFVDADKGNY 182

Query: 905  LNYHERLMKLVKVGGLLGYDNTLWNGSVVLPADAPMRKYIRYYRDFVLDLNKALAADQRV 1084
              YHERL++LV+ GG+L YDNTLW GSV L  D+ + ++ +  R  ++  N  +A D RV
Sbjct: 183  GEYHERLLRLVRAGGVLAYDNTLWGGSVALEDDSVLEEFDQDIRRSIVAFNAKIAGDPRV 242

Query: 1085 EICQLPVGDGITLCRR 1132
            E  QLPV DGITLCRR
Sbjct: 243  EAVQLPVSDGITLCRR 258
  9636.m03928|protein  O-methyltransferase
            Length = 234
            
 Score =  279 bits (706), Expect = 8e-75
 Identities = 132/229 (57%), Positives = 173/229 (74%), Gaps = 1/229 (0%)
 Frame = +2

Query: 452  GHKSLLQSDALYQYILETSVYPREHECMKELREITANHPWNLMTTSADEGQFLNMLLKLI 631
            G  +LL+SD++ +Y+L+T+VYPREHE ++ELR IT NHP + M +S D+ QF ++LLK+I
Sbjct: 7    GSNTLLKSDSILEYVLDTTVYPREHERLRELRLITQNHPKSFMGSSPDQMQFFSVLLKMI 66

Query: 632  GAKKTMEIGVYTGYSLLATALAIPDDGTILAMDINRENYELGLPCIEKAGVAHKIDFREG 811
            GA+  +E+GV+TGYSLLATALA+PDDG ++A+D++RE YELG P IE AGVAHK+DFR G
Sbjct: 67   GARNAVEVGVFTGYSLLATALALPDDGKVVAIDVSREYYELGRPVIEDAGVAHKVDFRHG 126

Query: 812  PALPVLDALLEDEANHGTFDFVFVDADKDNYLNYHERLMKLVKVGGLLGYDNTLWNGSVV 991
              L VLD LL      G FDF + DADK+ Y  YHERL++L++VGG++ YDNTLW GSV 
Sbjct: 127  DGLAVLDQLL--AGGEGKFDFAYADADKEQYRGYHERLVRLLRVGGVVAYDNTLWGGSVA 184

Query: 992  LPADAP-MRKYIRYYRDFVLDLNKALAADQRVEICQLPVGDGITLCRRAK 1138
            +P D P    Y R  RD+++  N  +AAD RVE C LPV DG+TLCRR K
Sbjct: 185  MPRDTPGSSAYDRVVRDYMVGFNAMVAADDRVEACLLPVADGVTLCRRLK 234
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103827697 Number of Sequences: 59712 Number of extensions: 3945068 Number of successful extensions: 96068 Number of sequences better than 1.0e-10: 28 Number of HSP's better than 0.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 95639 Number of HSP's gapped (non-prelim): 98 length of query: 448 length of database: 26,991,925 effective HSP length: 52 effective length of query: 396 effective length of database: 23,886,901 effective search space: 9459212796 effective search space used: 9459212796 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG620   Members:95             3pri:Y   6e-67       
Q00327           Photosystem I reaction center subunit V, chloroplast
precursor (PSI-G) (Photosystem I 9 kDa protein)
         (947 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9637.m02710|protein  photosystem i reaction center subunit...   222  7e-58
 9637.m01516|protein  chlorophyll a/b-binding protein I pre...   104  2e-22
 9629.m05067|protein  Chlorophyll A-B binding protein, puta...   104  2e-22
 9629.m03990|protein  Chlorophyll A-B binding protein, puta...   104  2e-22
 9631.m03807|protein  chlorophyll a/b binding protein             99  1e-20
 9635.m03724|protein  chlorophyll a-b binding protein of lh...    92  1e-18

  9637.m02710|protein  photosystem i reaction center subunit v,
           chloroplast precursor (psi-g)(photosystem i 9 kda
           protein)
           Length = 141
           
 Score =  222 bits (560), Expect = 7e-58
 Identities = 112/137 (81%), Positives = 123/137 (89%), Gaps = 3/137 (2%)
 Frame = +1

Query: 340 AAVLSPPAVAGLRLAPSPRA---AASFRGVSPPARRSVAARAALEPSVVISLSTGLSLVM 510
           A  LSPP VAGLRLAPSPR    + +FR  +P  RRSVAARA L PS+VISLSTG+SL +
Sbjct: 3   ATSLSPPTVAGLRLAPSPRVRSPSVAFRA-APARRRSVAARAELSPSLVISLSTGVSLFL 61

Query: 511 GRFVFFNFQRENVAKQVPEQNGKTHFEAGDERAKEFAGILKSNDPVGFNLVDVLAWGSIG 690
           GRFVFFNFQRENVAKQVPEQNGKTHF+AGDERAKEFAG+L+SNDPVGFNLVDVLAWGS+G
Sbjct: 62  GRFVFFNFQRENVAKQVPEQNGKTHFDAGDERAKEFAGLLRSNDPVGFNLVDVLAWGSLG 121

Query: 691 HIVAYYILATTSNGYDPPFF 750
           HIVAYYILAT SNGY+P FF
Sbjct: 122 HIVAYYILATCSNGYNPNFF 141
  9637.m01516|protein  chlorophyll a/b-binding protein I precursor -
           rice
           Length = 265
           
 Score =  104 bits (258), Expect = 2e-22
 Identities = 48/51 (94%), Positives = 50/51 (97%)
 Frame = -3

Query: 240 KNGRPAMFSMFGFFVQAIVSGKGPLENLADHLADPVNNNAWAFATNFVPGK 88
           KNGR AMFSMFGFFVQAIV+GKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct: 215 KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265
  9629.m05067|protein  Chlorophyll A-B binding protein, putative
           Length = 265
           
 Score =  104 bits (258), Expect = 2e-22
 Identities = 48/51 (94%), Positives = 50/51 (97%)
 Frame = -3

Query: 240 KNGRPAMFSMFGFFVQAIVSGKGPLENLADHLADPVNNNAWAFATNFVPGK 88
           KNGR AMFSMFGFFVQAIV+GKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct: 215 KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265
  9629.m03990|protein  Chlorophyll A-B binding protein, putative
           Length = 261
           
 Score =  104 bits (258), Expect = 2e-22
 Identities = 48/51 (94%), Positives = 50/51 (97%)
 Frame = -3

Query: 240 KNGRPAMFSMFGFFVQAIVSGKGPLENLADHLADPVNNNAWAFATNFVPGK 88
           KNGR AMFSMFGFFVQAIV+GKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct: 211 KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 261
  9631.m03807|protein  chlorophyll a/b binding protein
           Length = 263
           
 Score = 98.7 bits (242), Expect = 1e-20
 Identities = 54/86 (62%), Positives = 61/86 (70%), Gaps = 3/86 (3%)
 Frame = -3

Query: 345 GGGGGGHGPHSSFGAGAVWVGGCSG---TNAPRVLDLGKNGRPAMFSMFGFFVQAIVSGK 175
           GGG  G G    +  GA    G +    T A   +   KNGR AMFSMFGFFVQAIV+GK
Sbjct: 175 GGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGK 234

Query: 174 GPLENLADHLADPVNNNAWAFATNFVPGK 88
           GP+ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct: 235 GPIENLFDHVADPVANNAWAYATNFVPGK 263
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72437294 Number of Sequences: 59712 Number of extensions: 2669534 Number of successful extensions: 71861 Number of sequences better than 1.0e-10: 12 Number of HSP's better than 0.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 71854 Number of HSP's gapped (non-prelim): 6 length of query: 315 length of database: 26,991,925 effective HSP length: 51 effective length of query: 264 effective length of database: 23,946,613 effective search space: 6321905832 effective search space used: 6321905832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG624   Members:72             3pri:Y   1e-118      
AAL26573.1       putative fructokinase II [Oryza sativa]
dbj|BAC78556.1| fructokinase [Oryza sativa (japonica cultivar-group)]
         (1378 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9636.m00111|protein  pfkB family carbohydrate kinase            628  e-180
 9634.m01241|protein  probable fructokinase F28G11.11 [impo...   423  e-118
 9629.m06644|protein  pfkB family carbohydrate kinase            415  e-115
 9629.m06250|protein  SOUL heme-binding protein, putative        155  2e-37
 9631.m03901|protein  Similar to F4N2.16                         129  2e-29
 9629.m05120|protein  retrotransposon protein, putative, Ty...    94  7e-19
 9639.m04036|protein  transposon protein, putative, CACTA, ...    92  3e-18
 9636.m00525|protein  dna-directed rna polymerase ii larges...    90  1e-17
 9630.m00367|protein  transposon protein, putative, CACTA, ...    85  2e-16
 9633.m03752|protein  retrotransposon protein, putative, un...    82  2e-15
 9631.m04359|protein  transposon protein, putative, CACTA, ...    80  9e-15
 9631.m06019|protein expressed protein                            76  2e-13
 9629.m00408|protein  expressed protein                           75  2e-13
 9631.m03557|protein  putative protein kinase                     75  2e-13
 9634.m04142|protein  retrotransposon protein, putative, Ty...    75  4e-13
 9632.m03281|protein  transposon protein, putative, CACTA, ...    71  3e-12
 9632.m03280|protein  transposon protein, putative, CACTA, ...    71  3e-12
 9632.m03436|protein  transposon protein, putative, CACTA, ...    71  3e-12
 9638.m02460|protein  retrotransposon protein, putative, un...    71  4e-12
 9633.m00004|protein  transposon protein, putative, CACTA, ...    70  8e-12

  9636.m00111|protein  pfkB family carbohydrate kinase
            Length = 336
            
 Score =  628 bits (1603), Expect = e-180
 Identities = 309/336 (91%), Positives = 322/336 (94%)
 Frame = +3

Query: 96   MAPLGDAVAPAAAAAPGLVVSFGEMLIDFVPDVAGVSLAESGGFVKAPGGAPANVACAVS 275
            MAPLGD  A AAAA P LVVSFGEMLIDFVPDVAGVSLAESGGFVKAPGGAPANVACA+S
Sbjct: 1    MAPLGDGAAAAAAAEPNLVVSFGEMLIDFVPDVAGVSLAESGGFVKAPGGAPANVACAIS 60

Query: 276  KLGGSSAFVGKFGDDEFGHMLVEILKQNGVNAEGCLFDQHARTALAFVTLKANGEREFMF 455
            KLGGSSAFVGKFGDDEFGHMLV+ILK+NGVNAEGCLFD+HARTALAFVTLK+NGEREFMF
Sbjct: 61   KLGGSSAFVGKFGDDEFGHMLVDILKKNGVNAEGCLFDEHARTALAFVTLKSNGEREFMF 120

Query: 456  YRNPSADMLLTEAELNLDLIRRARIFHYGSISLITEPCRSAHVAAMRAAKSAGILCSYDP 635
            YRNPSADMLLTEAELNLDLIRRA+IFHYGSISLITEPCRSAHVAAMRAAKSAGILCSYDP
Sbjct: 121  YRNPSADMLLTEAELNLDLIRRAKIFHYGSISLITEPCRSAHVAAMRAAKSAGILCSYDP 180

Query: 636  NVRLPLWPSAQAARDGIMSIWKEADFIKVSDDEVAFLTQGDANDEKNVLSLWFEGLKLLI 815
            NVRLPLWPS  AAR GI+SIWKEADFIKVSDDEVAFLTQGDANDEKNVLSLWF+GLKLLI
Sbjct: 181  NVRLPLWPSEDAARAGILSIWKEADFIKVSDDEVAFLTQGDANDEKNVLSLWFDGLKLLI 240

Query: 816  VTDGEKGCRYFTKDFKGSVPGYSVNTVDTTGAGDAFVGSLLVNVSKDDSIFYNEAKLREV 995
            VTDGEKGCRYFTKDFKGSVPG+SVNTVDTTGAGDAFVGSLLVNV+KDDSIF+NE KLRE 
Sbjct: 241  VTDGEKGCRYFTKDFKGSVPGFSVNTVDTTGAGDAFVGSLLVNVAKDDSIFHNEEKLREA 300

Query: 996  LQFSNACGAICTTKKGAIPALPTTATALELISKGSN 1103
            L+FSNACGAICTTKKGAIPALPT A A ELISK +N
Sbjct: 301  LKFSNACGAICTTKKGAIPALPTVAVAQELISKAAN 336
  9634.m01241|protein  probable fructokinase F28G11.11 [imported] -
            Arabidopsis thaliana
            Length = 397
            
 Score =  423 bits (1075), Expect = e-118
 Identities = 205/324 (63%), Positives = 260/324 (79%), Gaps = 1/324 (0%)
 Frame = +3

Query: 123  PAAAAAPGLVVSFGEMLIDFVPDVAGVSLAESGGFVKAPGGAPANVACAVSKLGGSSAFV 302
            P  +++P  VV FGE+LIDFVP V GVSLAE+  F KAPGGAPANVA  +++LGGSSAF+
Sbjct: 71   PGTSSSPH-VVCFGELLIDFVPTVNGVSLAEASAFKKAPGGAPANVAVGIARLGGSSAFI 129

Query: 303  GKFGDDEFGHMLVEILKQNGVNAEGCLFDQHARTALAFVTLKANGEREFMFYRNPSADML 482
            GK GDDEFG+ML +ILK+N VN +G LFD HARTALAFVTL+ +GEREFMFYRNPSADML
Sbjct: 130  GKVGDDEFGYMLADILKENNVNNQGLLFDAHARTALAFVTLRNDGEREFMFYRNPSADML 189

Query: 483  LTEAELNLDLIRRARIFHYGSISLITEPCRSAHVAAMRAAKSAGILCSYDPNVRLPLWPS 662
            L E EL+LDLIR+A+IFH+GSISLITEPC++AH+AA +AAK AG+L SYDPN+RLPLW S
Sbjct: 190  LEEKELDLDLIRKAKIFHHGSISLITEPCKTAHIAAAKAAKDAGVLISYDPNLRLPLWSS 249

Query: 663  AQAARDGIMSIWKEADFIKVSDDEVAFLTQG-DANDEKNVLSLWFEGLKLLIVTDGEKGC 839
            A  ARDGI+SIW+ AD IK+S++EV+FLT+G D  D+  +  L    LKLL+VT+G +GC
Sbjct: 250  ADDARDGILSIWETADVIKISEEEVSFLTKGEDPYDDSVIKKLMHPNLKLLLVTEGPEGC 309

Query: 840  RYFTKDFKGSVPGYSVNTVDTTGAGDAFVGSLLVNVSKDDSIFYNEAKLREVLQFSNACG 1019
            RY++K+F G V G  VN VDTTGAGDAFV  +L  +S D S+  +E +L+E L+F+N CG
Sbjct: 310  RYYSKEFNGRVGGLKVNAVDTTGAGDAFVAGILSQLSVDFSLLQDEGRLKEALKFANVCG 369

Query: 1020 AICTTKKGAIPALPTTATALELISK 1094
            A+  T++GAIPALPT    ++ ++K
Sbjct: 370  ALTVTERGAIPALPTRQQVVDALTK 394
  9629.m06644|protein  pfkB family carbohydrate kinase
            Length = 323
            
 Score =  415 bits (1055), Expect = e-115
 Identities = 204/314 (64%), Positives = 249/314 (78%)
 Frame = +3

Query: 147  LVVSFGEMLIDFVPDVAGVSLAESGGFVKAPGGAPANVACAVSKLGGSSAFVGKFGDDEF 326
            LVVSFGEMLIDFVP VAGVSLAE+  FVKAPGGAPANVA AV++LGG +AFVGK GDDEF
Sbjct: 7    LVVSFGEMLIDFVPTVAGVSLAEAPAFVKAPGGAPANVAIAVARLGGGAAFVGKLGDDEF 66

Query: 327  GHMLVEILKQNGVNAEGCLFDQHARTALAFVTLKANGEREFMFYRNPSADMLLTEAELNL 506
            G ML  IL+ NGV+  G +FD  ARTALAFVTL+A+GEREFMFYRNPSADMLLT AELN+
Sbjct: 67   GRMLAAILRDNGVDDGGVVFDAGARTALAFVTLRADGEREFMFYRNPSADMLLTHAELNV 126

Query: 507  DLIRRARIFHYGSISLITEPCRSAHVAAMRAAKSAGILCSYDPNVRLPLWPSAQAARDGI 686
            +LI+RA +FHYGSISLI EPCRSAH+ AM  AK AG L SYDPN+R  LWPS + AR  I
Sbjct: 127  ELIKRAAVFHYGSISLIAEPCRSAHLRAMEIAKEAGALLSYDPNLREALWPSREEARTKI 186

Query: 687  MSIWKEADFIKVSDDEVAFLTQGDANDEKNVLSLWFEGLKLLIVTDGEKGCRYFTKDFKG 866
            +SIW +AD +KVS+ E+ FLT  D+ ++  V+ LW   +KLL+VT G++GC+Y+ +DF+G
Sbjct: 187  LSIWDQADIVKVSEVELEFLTGIDSVEDDVVMKLWRPTMKLLLVTLGDQGCKYYARDFRG 246

Query: 867  SVPGYSVNTVDTTGAGDAFVGSLLVNVSKDDSIFYNEAKLREVLQFSNACGAICTTKKGA 1046
            +VP Y V  VDTTGAGDAFVG+LL  + +D S   ++ KL E ++F+NACGAI  TKKGA
Sbjct: 247  AVPSYKVQQVDTTGAGDAFVGALLRRIVQDPSSLQDQKKLEEAIKFANACGAITATKKGA 306

Query: 1047 IPALPTTATALELI 1088
            IP+LPT    L+L+
Sbjct: 307  IPSLPTEVEVLKLM 320
  9629.m06250|protein  SOUL heme-binding protein, putative
            Length = 818
            
 Score =  155 bits (388), Expect = 2e-37
 Identities = 113/315 (35%), Positives = 168/315 (52%), Gaps = 53/315 (16%)
 Frame = +3

Query: 141  PGLVVSFGEMLIDFVP-----------DVAGVSLA---ESGGFVKAPGGAPANVACAVSK 278
            P LV  FG    +FVP           D+    L    E   F +APG A +NVA A+++
Sbjct: 441  PPLVCCFGAPRWEFVPTVRVSDRQMHPDIYSTWLHLQWEPPEFARAPGSAASNVAIALTR 500

Query: 279  LGGSSAFVGKFGDDEFGHMLVEILKQNGVNAEGCLFDQHARTALAFVTLK-------ANG 437
            LGG +A +GK GDD+FG  LV  +    V      FD  A TA A + +        + G
Sbjct: 501  LGGRAAVLGKVGDDDFGRELVYRMNCERVQTRAIRFDDGAATATARMKVGFRDREDGSGG 560

Query: 438  EREFMFYRNPSADMLLTEAELNLDLIRRARIFHYGSISLITEPCRSAHVAAMRAAKSAGI 617
             R        +A+  L++AE+N+D+++ AR+FH+ S  L+T    S    A+  +K  G 
Sbjct: 561  TRLVAETVKSAAEDSLSKAEINVDVLKEARVFHFNSEVLLTPSMESTLFRAIELSKKFGS 620

Query: 618  LCSYDPNVRLPLWPSAQAARDGIMSIWKEADFIKVSDDEVAFLTQGDANDEK-------- 773
               +D N+ LPLW S    ++ I   W EAD I+VS DE+ FL   +    K        
Sbjct: 621  KIFFDLNLPLPLWRSRDETKELINKAWNEADIIEVSRDELEFLLDHEYYQYKRANPPQYY 680

Query: 774  -------------------NVLSLWFEGLKLLIVTDGEKGCRYFTKDFKGSVPG-----Y 881
                                +  +W +G+KLL+VT G     Y+T  F G V G      
Sbjct: 681  LDGFHLTRNWPQYYHYTPEEIAPIWHDGIKLLLVTYGTLRIHYYTPKFHGCVIGTEDALI 740

Query: 882  SVNTVDTTGAGDAFVGSLLVNVSKDDSIFYNEAKLREVLQFSNACGAICTTKKGAIPALP 1061
            +  T D TG+GDA V + +  ++    ++ ++  L   L+F+ A G I     GA+   P
Sbjct: 741  TPYTTDRTGSGDAVVAAAIRKLTSCPEMYEDQDTLERNLRFAVAAGIISQWTIGAVRGFP 800

Query: 1062 TTATALEL 1085
            T + A  L
Sbjct: 801  TESAAQNL 808
  9631.m03901|protein  Similar to F4N2.16
            Length = 572
            
 Score =  129 bits (320), Expect = 2e-29
 Identities = 81/267 (30%), Positives = 143/267 (53%), Gaps = 21/267 (7%)
 Frame = +3

Query: 225  FVKAPGGAPANVACAVSKLGGSSAFVGKFGDDEFGHMLVEILKQNGVNAEGCLFDQHART 404
            FV+APGG+ +NVA A++  GG   F+GK GDD++G   +  L  NGV       D  A T
Sbjct: 245  FVRAPGGSSSNVALALAASGGRVEFMGKLGDDDYGQSTLYHLNVNGVQTRAIKMDPSAFT 304

Query: 405  ALAFVTLKANGEREFMFYRNPSADMLLTEAELNLDLIRRARIFHYGSISLITEPCRSAHV 584
            A++ + +  +                  + ++N  +++ A++F+Y S +L+    RS+  
Sbjct: 305  AMSLMKVTED---------------CFVQTDINPAVLKEAKMFYYNSSALLEPTTRSSLS 349

Query: 585  AAMRAAKSAGILCSYDPNVRLPLWPSAQAARDGIMSIWKEADFIKVSDDEVAFLTQ---- 752
             A+  +K  G +  +D N+ LPLW S++  +  +   W+ AD I+++  E+ FL      
Sbjct: 350  KAIEVSKKFGGVTFFDLNLPLPLWSSSKETKSLVKEAWEAADIIEITKQELEFLCGIKPS 409

Query: 753  ---GDANDEKN---------VLSLWFEGLKLLIVTDGEKGCRYFTKDFKGSVPG-----Y 881
               G  +++K+         V  LW E LK+L VT+G     Y+TK+  G V G      
Sbjct: 410  EKFGTKDNDKSKFTHYSPEVVTKLWHENLKVLFVTNGTSKIHYYTKEHDGWVRGTEDAPI 469

Query: 882  SVNTVDTTGAGDAFVGSLLVNVSKDDSIFYNEAKLREVLQFSNACGAI 1025
            +  T D + +GDA V +L+  ++ +  +  ++  L   ++ +  CG I
Sbjct: 470  TPFTGDMSQSGDAIVAALMKMLAINPHLVTDKDYLHTAMKHAITCGVI 517
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97382947 Number of Sequences: 59712 Number of extensions: 3520389 Number of successful extensions: 99741 Number of sequences better than 1.0e-10: 45 Number of HSP's better than 0.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 22 Number of HSP's that attempted gapping in prelim test: 97657 Number of HSP's gapped (non-prelim): 311 length of query: 459 length of database: 26,991,925 effective HSP length: 52 effective length of query: 406 effective length of database: 23,886,901 effective search space: 9698081806 effective search space used: 9698081806 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG634   Members:83             3pri:Y   1e-120      
T06204           hypothetical protein pBH6-12 - barley emb|CAA74593.1|
hypothetical protein [Hordeum vulgare]
         (855 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9638.m03081|protein  putative basic secretory protein           314  1e-85
 9638.m03079|protein  putative secretory protein                 289  6e-78
 9638.m03080|protein  putative secretory protein                 227  8e-63

  9638.m03081|protein  putative basic secretory protein
           Length = 229
           
 Score =  314 bits (796), Expect = 1e-85
 Identities = 150/226 (66%), Positives = 182/226 (80%), Gaps = 3/226 (1%)
 Frame = +2

Query: 14  MKISIAAAAVLLLALAAT---ASAVTFDVTNEASSTAGGQRFDREYGAAYAKQVLSDASS 184
           MK+ + AA +L +A +++   A+AVT++V+NEA+STAGGQRFDREYGA YAKQVL+ ASS
Sbjct: 1   MKLHVVAAILLAVAASSSPPPAAAVTYEVSNEAASTAGGQRFDREYGAGYAKQVLAAASS 60

Query: 185 FTWGIFNQPDPSDRRPADGDTVTLAVRDTNGIASTSGSTIELSARSVGGITGDNLKEQVD 364
           FTW IF+QP  +DRRP D   V LAVRD +GIASTSG+TI L A  V G+TG++ K QV 
Sbjct: 61  FTWSIFSQPSAADRRPVDA--VVLAVRDVDGIASTSGNTITLGAGYVAGVTGNDFKTQVT 118

Query: 365 GVLYHEVVHVWQWGLQDYHEHHGIFEGIADYVRLKAGYVAANWVKEGGGSRWDEGYDVTA 544
           GVLYHEVVHVWQWGLQDY  H  ++EGIAD+VRL+AGY AA WV+ G G+ W++ Y VTA
Sbjct: 119 GVLYHEVVHVWQWGLQDYGAHSWVYEGIADFVRLRAGYPAAGWVQPGQGNSWEDSYSVTA 178

Query: 545 RFLDYCDSRKPGFVAEMNGKLKDGYNDDYFVQILGTSADQLWNDYKAKY 691
           RF DYCDS KPGFVA++N KLK+GYN DYFVQI G +  QLW DYKAKY
Sbjct: 179 RFFDYCDSVKPGFVADLNAKLKNGYNVDYFVQITGKTVQQLWQDYKAKY 227
  9638.m03079|protein  putative secretory protein
           Length = 233
           
 Score =  289 bits (731), Expect = 6e-78
 Identities = 142/223 (63%), Positives = 164/223 (72%), Gaps = 3/223 (1%)
 Frame = +2

Query: 23  SIAAAAVLLLALAATASAVTFDVTNEASSTAGGQRFDREYGAAYAKQVLSDASSFTWGIF 202
           ++AA      A A  A AVTFD TN ASSTAGGQRFDRE G  YAKQVL+DASSF W  F
Sbjct: 8   TLAALMAAAAAAATAAGAVTFDATNTASSTAGGQRFDREVGVDYAKQVLADASSFIWDAF 67

Query: 203 NQP-DPSDRRPADGDTVTLAVRDTNGIASTSGSTIELSARSVGGITGDN--LKEQVDGVL 373
            QP D  DR+P D   VTL V D +G+A TSG  I LSAR VGG +  +  ++ +V GVL
Sbjct: 68  EQPGDGGDRKPVDA--VTLTVEDIDGVAFTSGDGIHLSARYVGGYSSSSGDVRTEVTGVL 125

Query: 374 YHEVVHVWQWGLQDYHEHHGIFEGIADYVRLKAGYVAANWVKEGGGSRWDEGYDVTARFL 553
           YHE  HVWQWGLQDY  H  ++EGIAD+VRL+AGYVAA WV+ G G+ W++ Y VTARF 
Sbjct: 126 YHEATHVWQWGLQDYAAHSWVYEGIADFVRLRAGYVAAGWVQPGQGNSWEDSYSVTARFF 185

Query: 554 DYCDSRKPGFVAEMNGKLKDGYNDDYFVQILGTSADQLWNDYKAKY 691
           DYCDS KPGFVA++N KLKDGYN DYFVQI G +  QLW DYKAKY
Sbjct: 186 DYCDSVKPGFVADINAKLKDGYNVDYFVQITGKTVQQLWQDYKAKY 231
  9638.m03080|protein  putative secretory protein
           Length = 260
           
 Score =  227 bits (572), Expect(2) = 8e-63
 Identities = 114/187 (60%), Positives = 138/187 (72%), Gaps = 4/187 (2%)
 Frame = +2

Query: 131 DREYGAAYAKQVLSDASSFTWGIFNQP-DPSDRRPADGDTVTLAVRDTNGIASTSGSTIE 307
           DRE G  YAKQ+L+DASSF W  F QP D  DR+P D   VTL V D +G+A TSG  I 
Sbjct: 71  DREVGVDYAKQMLADASSFIWDTFEQPGDGGDRKPVDA--VTLTVEDIDGVAFTSGDGIH 128

Query: 308 LSARSVGGITG-DNLKEQVDGVLYHEVVHVWQWGLQDYHEHHGIFEGIADYVRLKAGYVA 484
           LSAR VGG +   +++ +V GVLYHE  HVWQW  +   +  G+ EGIAD+VRL+AGY  
Sbjct: 129 LSARYVGGYSAAGDVRAEVTGVLYHEATHVWQWDGRGGADG-GLIEGIADFVRLRAGYAP 187

Query: 485 ANWVKEGGGSRWDEGYDVTARFLDYCDSRK--PGFVAEMNGKLKDGYNDDYFVQILGTSA 658
            +WV+ G G RWD+GYDVTARFLDYCDS     GFVA++NGK+KDGY+DD+FVQI G + 
Sbjct: 188 PHWVQPGQGDRWDQGYDVTARFLDYCDSPAVVQGFVAQLNGKMKDGYSDDFFVQISGKTI 247

Query: 659 DQLWNDYKAKY 691
           DQLW DYKAKY
Sbjct: 248 DQLWQDYKAKY 258
 Score = 33.6 bits (75), Expect(2) = 8e-63
 Identities = 18/28 (64%), Positives = 21/28 (74%), Gaps = 6/28 (21%)
 Frame = +1

Query: 58  GSHG*RGH------VRRDERGVEHSRRPAIRQGV 141
           G+HG RG       VRRDE GVEH RR A+ + V
Sbjct: 41  GAHGRRGRDGRRRDVRRDEHGVEHRRRAAVDREV 74
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62420153 Number of Sequences: 59712 Number of extensions: 2130528 Number of successful extensions: 56018 Number of sequences better than 1.0e-10: 6 Number of HSP's better than 0.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 56005 Number of HSP's gapped (non-prelim): 4 length of query: 285 length of database: 26,991,925 effective HSP length: 50 effective length of query: 234 effective length of database: 24,006,325 effective search space: 5617480050 effective search space used: 5617480050 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG635   Members:118            3pri:Y   3e-45       
P13194           Photosystem I reaction center subunit IV, chloroplast
precursor (PSI-E) (Photosystem I 10.8 kDa polypeptide)
         (867 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9635.m02437|protein  photosystem i reaction center subunit...   213  2e-55

  9635.m02437|protein  photosystem i reaction center subunit iv
           (psi-e).
           Length = 149
           
 Score =  213 bits (538), Expect = 2e-55
 Identities = 117/145 (80%), Positives = 127/145 (86%), Gaps = 5/145 (3%)
 Frame = +3

Query: 114 MAST-NMASATSRFMLAAGIPSGANGGVSSRVSFLPSNRLGLKLVA-RAEEPTAAAPAEP 287
           MAST N+ASATSRF+LA G   G+ GG +SRVSF  +NR+G ++V  RAEE  AA P  P
Sbjct: 1   MASTINVASATSRFLLAGG-NGGSGGGGASRVSFA-ANRVGRRMVVVRAEEEAAAPPPPP 58

Query: 288 APAADEKP---EAAVATKEPAKAKPPPRGPKRGTKVKILRRESYWYNGTGSVVTVDQDPN 458
            PAA+EKP   EAAVATKEPA AKPPP GPKRGTKVKILRRESYWYNGTGSVVTVDQDPN
Sbjct: 59  PPAAEEKPAEAEAAVATKEPAAAKPPPIGPKRGTKVKILRRESYWYNGTGSVVTVDQDPN 118

Query: 459 TRYPVVVRFAKVNYAGVSTNNYALDEIKEV 548
           TRYPVVVRFAKVNYAGVSTNNYALDEI+EV
Sbjct: 119 TRYPVVVRFAKVNYAGVSTNNYALDEIQEV 148
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62038857 Number of Sequences: 59712 Number of extensions: 2227625 Number of successful extensions: 30525 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 30521 Number of HSP's gapped (non-prelim): 1 length of query: 289 length of database: 26,991,925 effective HSP length: 50 effective length of query: 238 effective length of database: 24,006,325 effective search space: 5713505350 effective search space used: 5713505350 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG636   Members:267            3pri:Y   1e-150      
P27523           Chlorophyll A-B binding protein of LHCII type III,
chloroplast precursor (CAB)
         (1135 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9635.m03724|protein  chlorophyll a-b binding protein of lh...   485  e-137
 9631.m03807|protein  chlorophyll a/b binding protein            370  e-102
 9637.m01516|protein  chlorophyll a/b-binding protein I pre...   351  1e-96
 9629.m05067|protein  Chlorophyll A-B binding protein, puta...   351  1e-96
 9629.m03990|protein  Chlorophyll A-B binding protein, puta...   350  3e-96
 9637.m00977|protein  Chlorophyll A-B binding protein, puta...   211  2e-54
 9639.m01284|protein  chlorophyll a/b-binding protein CP26 ...   202  1e-51
 9635.m03882|protein  LHCI-680, photosystem I antenna prote...   132  1e-30
 9634.m02114|protein  chlorophyll a/b-binding protein precu...   131  2e-30
 9630.m00958|protein  chlorophyll a/b-binding protein type ...   126  6e-29
 9637.m02343|protein  AY086461 PSI type II chlorophyll a/b-...   120  6e-27
 9635.m03689|protein  probable chlorophyll a/b-binding prot...   119  8e-27
 9630.m05194|protein  light-harvesting complex protein [imp...   118  2e-26
 9639.m01283|protein  chlorophyll a/b-binding protein CP26 ...   113  6e-25
 9636.m03389|protein  chlorophyll a/b-binding protein presu...   105  1e-22
 9632.m03624|protein  chlorophyll a/b-binding apoprotein CP...   104  2e-22
 9630.m00957|protein  chlorophyll a/b-binding protein type ...    82  1e-15

  9635.m03724|protein  chlorophyll a-b binding protein of lhcii type
           iii, chloroplastprecursor (cab)
           Length = 266
           
 Score =  485 bits (1236), Expect = e-137
 Identities = 234/268 (87%), Positives = 248/268 (92%)
 Frame = +2

Query: 65  MASTIMAAASRAVVAKTPFLSGQGRAASASPLRDIAAATNGRITMGNDLWYGPDRVKYLG 244
           MASTIMA  SR + AKTPFL G  R ++A P+RDIAAA  GRITM  +LWYGPDRVKYLG
Sbjct: 1   MASTIMAPTSRVLAAKTPFL-GHPRPSNA-PVRDIAAAATGRITMSKELWYGPDRVKYLG 58

Query: 245 PFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCVFPEVLQ 424
           PFSAQTPSYL GEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGC+ PEVL+
Sbjct: 59  PFSAQTPSYLRGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCITPEVLE 118

Query: 425 KWVGVEFKEPVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGFQVLLMGLVEGFRING 604
           KWV V+FKEPVWFKAG+QIFS+GGLDYLGNPNLVHAQSILAVLGFQV+LMGLVEG+RING
Sbjct: 119 KWVRVDFKEPVWFKAGAQIFSDGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGYRING 178

Query: 605 LDGVGEGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 784
           L GVG+GNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG
Sbjct: 179 LPGVGDGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 238

Query: 785 PLENLFDHLDDPVANNAWVFATKFAPGS 868
           PLENL DHL DPVANNAWV+ATKF PGS
Sbjct: 239 PLENLLDHLADPVANNAWVYATKFTPGS 266
  9631.m03807|protein  chlorophyll a/b binding protein
           Length = 263
           
 Score =  370 bits (940), Expect = e-102
 Identities = 191/259 (73%), Positives = 208/259 (79%), Gaps = 8/259 (3%)
 Frame = +2

Query: 89  ASRAVVAKTPFLSGQGRAASASPLRDIAAATNGRITMGN-------DLWYGPDRVKYLGP 247
           A+ A+   T FL   G A     L      + GRITM          +WYGPDR KYLGP
Sbjct: 2   AASALHQTTSFL---GTAPRRDELVRRVGDSGGRITMRRTVKSAPQSIWYGPDRPKYLGP 58

Query: 248 FSAQTPSYLNGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCVFPEVLQK 427
           FS QTPSYL GEFPGDYGWDTAGLSADPE FARNR LEVIH RWAMLGALGCVFPE+L K
Sbjct: 59  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK 118

Query: 428 WVGVEFKEPVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGFQVLLMGLVEGFRINGL 607
             GV+F E VWFKAG+QIFSEGGLDYLGNPNLVHAQSILA+   QV+LMG VEG+R+ G 
Sbjct: 119 -NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGG- 176

Query: 608 DGVGEGND-LYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 784
             +GEG D +YPGG  FDPLGLADDP TFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKG
Sbjct: 177 GPLGEGLDKVYPGGA-FDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKG 235

Query: 785 PLENLFDHLDDPVANNAWVFATKFAPG 865
           P+ENLFDH+ DPVANNAW +AT F PG
Sbjct: 236 PIENLFDHVADPVANNAWAYATNFVPG 262
  9637.m01516|protein  chlorophyll a/b-binding protein I precursor -
           rice
           Length = 265
           
 Score =  351 bits (891), Expect = 1e-96
 Identities = 183/267 (68%), Positives = 202/267 (75%), Gaps = 1/267 (0%)
 Frame = +2

Query: 65  MASTIMAAASRAVVAKTPFLSGQGRAASASPLRDIAAATNGRITMGNDLWYGPDRVKYLG 244
           MA+  MA +S  +    P  S      +   +R  AA      + G+  WYG DRV YLG
Sbjct: 1   MAAATMALSSPVMARAAPSTSSALFGEARITMRKTAAKPKPAASSGSP-WYGADRVLYLG 59

Query: 245 PFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCVFPEVLQ 424
           P S + PSYL GEFPGDYGWDTAGLSADPE FA+NR LEVIH RWAMLGALGCVFPE+L 
Sbjct: 60  PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLA 119

Query: 425 KWVGVEFKEPVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGFQVLLMGLVEGFRING 604
           +  GV+F E VWFKAGSQIFSEGGLDYLGNP+L+HAQSILA+   QV+LMG VEG+RI G
Sbjct: 120 R-NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAG 178

Query: 605 LDGVGEGND-LYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGK 781
              +GE  D LYPGG  FDPLGLADDP  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGK
Sbjct: 179 -GPLGEVVDPLYPGGA-FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGK 236

Query: 782 GPLENLFDHLDDPVANNAWVFATKFAPG 865
           GPLENL DHL DPV NNAW +AT F PG
Sbjct: 237 GPLENLADHLADPVNNNAWAYATNFVPG 264
  9629.m05067|protein  Chlorophyll A-B binding protein, putative
           Length = 265
           
 Score =  351 bits (891), Expect = 1e-96
 Identities = 183/267 (68%), Positives = 204/267 (75%), Gaps = 1/267 (0%)
 Frame = +2

Query: 65  MASTIMAAASRAVVAKTPFLSGQGRAASASPLRDIAAATNGRITMGNDLWYGPDRVKYLG 244
           MA++ MA +S A +A     + +        +R  AA        G+  WYG DRV YLG
Sbjct: 1   MAASTMALSSPAALAGKAVANAKVFGEGRVTMRKSAAKPKPAAASGSP-WYGADRVLYLG 59

Query: 245 PFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCVFPEVLQ 424
           P S + PSYL GEFPGDYGWDTAGLSADPE FA+NR LEVIH RWAMLGALGCVFPE+L 
Sbjct: 60  PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA 119

Query: 425 KWVGVEFKEPVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGFQVLLMGLVEGFRING 604
           +  GV+F E VWFKAGSQIFSEGGLDYLGNP+L+HAQSILA+ G QV+LMG VEG+R+ G
Sbjct: 120 R-NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWGCQVVLMGAVEGYRVAG 178

Query: 605 LDGVGEGND-LYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGK 781
              +GE  D LYPGG  FDPLGLADDP  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGK
Sbjct: 179 -GPLGEVVDPLYPGGS-FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGK 236

Query: 782 GPLENLFDHLDDPVANNAWVFATKFAPG 865
           GPLENL DHL DPV NNAW +AT F PG
Sbjct: 237 GPLENLADHLADPVNNNAWAYATNFVPG 264
  9629.m03990|protein  Chlorophyll A-B binding protein, putative
           Length = 261
           
 Score =  350 bits (888), Expect = 3e-96
 Identities = 184/267 (68%), Positives = 202/267 (74%), Gaps = 2/267 (0%)
 Frame = +2

Query: 65  MASTIMAAASRAVVAKTPF-LSGQGRAASASPLRDIAAATNGRITMGNDLWYGPDRVKYL 241
           MA+  MA +S A+  K    + G+GR            A +G        WYG DRV YL
Sbjct: 1   MAAATMALSSPALAGKAAAKVFGEGRITMRKSAAKPKPAASG------SPWYGADRVLYL 54

Query: 242 GPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCVFPEVL 421
           GP S + PSYL GEFPGDYGWDTAGLSADPE FA+NR LEVIH RWAMLGALGCVFPE+L
Sbjct: 55  GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL 114

Query: 422 QKWVGVEFKEPVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGFQVLLMGLVEGFRIN 601
            +  GV+F E VWFKAGSQIFSEGGLDYLGNP+L+HAQSILA+   QV+LMG VEG+RI 
Sbjct: 115 AR-NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIA 173

Query: 602 GLDGVGEGND-LYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTG 778
           G   +GE  D LYPGG  FDPLGLADDP  FAELKVKEIKNGRLAMFSMFGFFVQAIVTG
Sbjct: 174 G-GPLGEVVDPLYPGGS-FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTG 231

Query: 779 KGPLENLFDHLDDPVANNAWVFATKFAPG 865
           KGPLENL DHL DPV NNAW +AT F PG
Sbjct: 232 KGPLENLADHLADPVNNNAWAYATNFVPG 260
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80675479 Number of Sequences: 59712 Number of extensions: 2723699 Number of successful extensions: 40888 Number of sequences better than 1.0e-10: 34 Number of HSP's better than 0.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 40813 Number of HSP's gapped (non-prelim): 27 length of query: 378 length of database: 26,991,925 effective HSP length: 51 effective length of query: 326 effective length of database: 23,946,613 effective search space: 7806595838 effective search space used: 7806595838 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG652   Members:34             3pri:Y   5e-60       
NP_182239.1      ADP-ribosylation factor 1 (ARF1) [Arabidopsis
thaliana] sp|P36397|ARF1_ARATH ADP-ribosylation factor 1
         (1151 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9633.m03842|protein  ADP-ribosylation factor [imported] - ...   231  2e-60
 9635.m01196|protein  ADP-ribosylation factor family             230  3e-60
 9631.m05882|protein  ADP-ribosylation factor                    230  3e-60
 9631.m05881|protein  ADP-ribosylation factor                    230  3e-60
 9635.m01193|protein  ADP-ribosylation factor family, putative   230  3e-60
 9629.m01594|protein  ADP-ribosylation factor family             229  7e-60
 9629.m05876|protein  ADP-ribosylation factor family             225  1e-58
 9636.m01507|protein  ADP-ribosylation factor 3 - Arabidops...   146  9e-35
 9630.m04581|protein  ADP-ribosylation factor family             145  2e-34
 9638.m03942|protein  putative ADP-ribosylation factor           143  4e-34
 9630.m00263|protein  ADP-ribosylation factor family             137  3e-32
 9639.m03408|protein  Similar to AY086337 ADP-ribosylation ...   133  6e-31
 9634.m00141|protein  ADP-ribosylation factor family             123  4e-28
 9630.m02130|protein  probable adp-ribosylation factor at2g...   117  4e-26
 9638.m03941|protein  putative ADP-ribosylation factor            91  3e-18
 9631.m02711|protein  putative GTP-binding protein                86  1e-16
 9635.m04291|protein  ADP-ribosylation factor family, putative    86  1e-16
 9631.m00948|protein  AY114718 ADP-ribosylation factor-like...    73  1e-12
 9630.m04896|protein  ADP-ribosylation factor-like protein        71  4e-12
 9638.m03940|protein  putative ADP-ribosylation factor            67  7e-11

  9633.m03842|protein  ADP-ribosylation factor [imported] - rice
           Length = 181
           
 Score =  231 bits (582), Expect = 2e-60
 Identities = 108/115 (93%), Positives = 113/115 (97%)
 Frame = -2

Query: 565 DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIAEARDELHRMLNEDELRNAVLLVFAN 386
           DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+R+ EARDELHRMLNEDELR+AVLLVFAN
Sbjct: 67  DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFAN 126

Query: 385 KQDLPNAMNAAEITDKLGLHSLRQRHWYIQSACATSGEGLYEGLDWLSNNIASKS 221
           KQDLPNAMNAAEITDKLGLHSLRQRHWYIQS CATSGEGLYEGLDWLSNNIA+K+
Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 181
  9635.m01196|protein  ADP-ribosylation factor family
           Length = 181
           
 Score =  230 bits (581), Expect = 3e-60
 Identities = 108/115 (93%), Positives = 113/115 (97%)
 Frame = -2

Query: 565 DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIAEARDELHRMLNEDELRNAVLLVFAN 386
           DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+ EARDELHRMLNEDELR+AVLLVFAN
Sbjct: 67  DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFAN 126

Query: 385 KQDLPNAMNAAEITDKLGLHSLRQRHWYIQSACATSGEGLYEGLDWLSNNIASKS 221
           KQDLPNAMNAAEITDKLGLHSLRQRHWYIQS CAT+GEGLYEGLDWLS+NIASK+
Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKA 181
  9631.m05882|protein  ADP-ribosylation factor
           Length = 181
           
 Score =  230 bits (581), Expect = 3e-60
 Identities = 108/115 (93%), Positives = 113/115 (97%)
 Frame = -2

Query: 565 DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIAEARDELHRMLNEDELRNAVLLVFAN 386
           DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+ EARDELHRMLNEDELR+AVLLVFAN
Sbjct: 67  DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFAN 126

Query: 385 KQDLPNAMNAAEITDKLGLHSLRQRHWYIQSACATSGEGLYEGLDWLSNNIASKS 221
           KQDLPNAMNAAEITDKLGLHSLRQRHWYIQS CAT+GEGLYEGLDWLS+NIASK+
Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKA 181
  9631.m05881|protein  ADP-ribosylation factor
           Length = 181
           
 Score =  230 bits (581), Expect = 3e-60
 Identities = 108/115 (93%), Positives = 113/115 (97%)
 Frame = -2

Query: 565 DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIAEARDELHRMLNEDELRNAVLLVFAN 386
           DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+ EARDELHRMLNEDELR+AVLLVFAN
Sbjct: 67  DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFAN 126

Query: 385 KQDLPNAMNAAEITDKLGLHSLRQRHWYIQSACATSGEGLYEGLDWLSNNIASKS 221
           KQDLPNAMNAAEITDKLGLHSLRQRHWYIQS CAT+GEGLYEGLDWLS+NIASK+
Sbjct: 127 KQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKA 181
  9635.m01193|protein  ADP-ribosylation factor family, putative
           Length = 304
           
 Score =  230 bits (581), Expect = 3e-60
 Identities = 108/115 (93%), Positives = 113/115 (97%)
 Frame = -2

Query: 565 DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIAEARDELHRMLNEDELRNAVLLVFAN 386
           DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+ EARDELHRMLNEDELR+AVLLVFAN
Sbjct: 190 DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFAN 249

Query: 385 KQDLPNAMNAAEITDKLGLHSLRQRHWYIQSACATSGEGLYEGLDWLSNNIASKS 221
           KQDLPNAMNAAEITDKLGLHSLRQRHWYIQS CAT+GEGLYEGLDWLS+NIASK+
Sbjct: 250 KQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKA 304
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71062400 Number of Sequences: 59712 Number of extensions: 2075617 Number of successful extensions: 42512 Number of sequences better than 1.0e-10: 40 Number of HSP's better than 0.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 42489 Number of HSP's gapped (non-prelim): 20 length of query: 383 length of database: 26,991,925 effective HSP length: 51 effective length of query: 332 effective length of database: 23,946,613 effective search space: 7950275516 effective search space used: 7950275516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG653   Members:8              3pri:Y   4e-05       
AAO39550.1       RE04347p [Drosophila melanogaster]
         (921 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9631.m01037|protein  hypothetical protein                       256  6e-68
 9634.m05009|protein  transposon protein, putative, CACTA, ...    70  6e-12
 9629.m00785|protein  transposon protein, putative, CACTA, ...    67  4e-11

  9631.m01037|protein  hypothetical protein
           Length = 391
           
 Score =  256 bits (646), Expect = 6e-68
 Identities = 159/227 (70%), Positives = 181/227 (79%), Gaps = 39/227 (17%)
 Frame = -3

Query: 898 EEDDGYKKKPSAGGYGD--GGGYEDE--YKKRPT---GGHGGGRYEEDDEYKKKPT---- 752
           EE++ YKKKP++GG G   GG YE+E  YKK+PT   GG+GGG YEE+D+YKKKP+    
Sbjct: 137 EEEEDYKKKPTSGGGGGYGGGRYEEEDNYKKKPTSGGGGYGGGMYEEEDDYKKKPSSGGG 196

Query: 751 GGHGGGRYEEDDEY-KRPSGGGH-GGRYEEE--DYKKKPS-------GGGRYEEDDYKKK 605
           GG+GGGRYEE+DEY K+PSGGG+ GGRYEEE  DY KKPS       GGGRY ED+YKKK
Sbjct: 197 GGYGGGRYEEEDEYRKKPSGGGYGGGRYEEEEDDYMKKPSAGAGGYGGGGRY-EDEYKKK 255

Query: 604 PS---GGGRYEEDD-YKKKPSGGSHGGKDESEGGGFG------DYLKL----AQGFMKKQ 467
           P    GGGRYEEDD Y KKPSGG   G   S GGG G      DY K     + G   + 
Sbjct: 256 PGGGHGGGRYEEDDEYNKKPSGGY--GYGASSGGGHGGRYEEDDYKKKPSAHSGGGGGRY 313

Query: 466 DGEGGHKKTSGHGGG-YGKEENEEDSGKKKHGGRPESGKDESEGSGMSDYLKLAQGFMKK 290
           + E G+KK SGHGGG YGKEE E+D  KKKHG       + SEG GM DYLKLAQG MKK
Sbjct: 314 EEEEGYKKPSGHGGGRYGKEEEEDDKKKKKHG-------EGSEG-GMGDYLKLAQGLMKK 365

Query: 289 DGEGG--SGAGMGDYLKLAEGFMKKR 218
            G  G   G GMGDYLKLAEGF+KKR
Sbjct: 366 QGGEGESGGGGMGDYLKLAEGFLKKR 391
 Score =  209 bits (526), Expect = 7e-54
 Identities = 130/204 (63%), Positives = 149/204 (72%), Gaps = 63/204 (30%)
 Frame = -3

Query: 901 YEEDDGYKKKPSAGGYGDGGGY---EDEYKKRPT----GGHGGGRYEEDDEYKKKPT-GG 746
           YEE+D YKKKP++GG G GGG    ED+YKK+P+    GG+GGGRYEE+DEY+KKP+ GG
Sbjct: 159 YEEEDNYKKKPTSGGGGYGGGMYEEEDDYKKKPSSGGGGGYGGGRYEEEDEYRKKPSGGG 218

Query: 745 HGGGRYEE----------------------DDEYKRPSGGGH-GGRYEEED-YKKKPSG- 641
           +GGGRYEE                      +DEYK+  GGGH GGRYEE+D Y KKPSG 
Sbjct: 219 YGGGRYEEEEDDYMKKPSAGAGGYGGGGRYEDEYKKKPGGGHGGGRYEEDDEYNKKPSGG 278

Query: 640 -----------GGRYEEDDYKKKPS-----GGGRYEEDDYKKKPS--GGSHGGKDESEG- 518
                      GGRYEEDDYKKKPS     GGGRYEE++  KKPS  GG   GK+E E  
Sbjct: 279 YGYGASSGGGHGGRYEEDDYKKKPSAHSGGGGGRYEEEEGYKKPSGHGGGRYGKEEEEDD 338

Query: 517 -----------GGFGDYLKLAQGFMKKQDGEGGHKKTSGHGGGYGKEENEEDSGKKKHGG 371
                      GG GDYLKLAQG MKKQ GEG                            
Sbjct: 339 KKKKKHGEGSEGGMGDYLKLAQGLMKKQGGEG---------------------------- 370

Query: 370 RPESGKDESEGSGMSDYLKLAQGFMKK 290
                  ES G GM DYLKLA+GF+KK
Sbjct: 371 -------ESGGGGMGDYLKLAEGFLKK 390
  9634.m05009|protein  transposon protein, putative, CACTA, En/Spm
           sub-class
           Length = 246
           
 Score = 69.9 bits (168), Expect = 6e-12
 Identities = 71/202 (35%), Positives = 78/202 (38%), Gaps = 3/202 (1%)
 Frame = -3

Query: 862 GGYGDGGGYEDEYKKRPTGGHGGGRYEEDDEYKKKPTGGHGGGRYEEDDEYKRPSGGGHG 683
           GGYG G GY   Y     GG GGG Y     Y     GG G G Y +   Y   +GGG G
Sbjct: 48  GGYGHGYGYGSGYGFG-NGGVGGGGYGGGGGYGSG--GGEGNGAYGQGYGYGSGNGGGGG 104

Query: 682 GRYEEEDYKKKPSGGGRYEEDDYKKKPSGGGRYEEDDYKKKPSGGSHGGKDESEGGGFGD 503
           G Y          GGG Y          GGG     DY  +  GG HGG     GGG   
Sbjct: 105 GGY-------GGGGGGSYGSGG-MGSGYGGGYGSGYDYGGQGGGGGHGG----GGGGGSG 152

Query: 502 YLKLAQGFMKKQDGEGGHKKTSGHGGGYGKEENEEDSGKKKHGGRPESGKDESEGSGMSD 323
           Y            G GG+   SG G GYG       SG   +GG   SG     G G S 
Sbjct: 153 Y------------GNGGY--GSGFGEGYG-------SGGGVNGG-GGSGGGGGGGGGASG 190

Query: 322 Y---LKLAQGFMKKDGEGGSGAGMG 257
           Y       +G+    G GG G G G
Sbjct: 191 YRYGAGYGKGYGYGGGPGGGGGGAG 215
  9629.m00785|protein  transposon protein, putative, CACTA, En/Spm
           sub-class
           Length = 520
           
 Score = 67.1 bits (161), Expect = 4e-11
 Identities = 71/209 (33%), Positives = 79/209 (36%), Gaps = 12/209 (5%)
 Frame = +3

Query: 222 FFMNPS---ASFK*SP-IPAPLPPSPSFFMKPCASFR*SDMPLPSDSSFPLSGRPPCFFL 389
           FF  P    A+F+  P +PA  PPSP     P  S      P PS S  P S  PP    
Sbjct: 359 FFARPPVNCAAFQCKPFVPALPPPSPPPPSPPPPSPPPPSPPPPSTSPPPPSPPPP---- 414

Query: 390 PLSSSFSSLPYPPPWPLVFLCPPSPSCFFMKPCASFK*SPKPPPSDSSFPPW--LPPLGF 563
                 S  P  PP P     PP P              P PPP+    PP   LPP   
Sbjct: 415 ------SPPPPSPPPPAPIFHPPQPP------------PPPPPPAPQPHPPCPELPPP-- 454

Query: 564 FL*SSSSYLPPPLGFFL*SSSSYLPPPLGFFL*SSSSYRPPWPPPLGLLYSSSSSYLPPP 743
                    PPP            PPP G    ++ +  PP PPP          Y P P
Sbjct: 455 ---------PPP------------PPPCGG---ATPALSPPPPPP----------YYPGP 480

Query: 744 WPPVGFFLYSSSSSYLPPP------WPPVGLFLYSSSYPPP 848
           WPPV    Y S     PPP      WPP+    Y S  PPP
Sbjct: 481 WPPVHGVPYGSPP---PPPLQHHSSWPPIHSVPYGSPPPPP 518
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65598861 Number of Sequences: 59712 Number of extensions: 2624522 Number of successful extensions: 24637 Number of sequences better than 1.0e-10: 6 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 24346 Number of HSP's gapped (non-prelim): 42 length of query: 307 length of database: 26,991,925 effective HSP length: 51 effective length of query: 255 effective length of database: 23,946,613 effective search space: 6106386315 effective search space used: 6106386315 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG680   Members:414            3pri:Y   1e-176      
AAK32118.1       plasmalemma H+-ATPase 1 [Hordeum vulgare]
         (3411 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9632.m05471|protein  plasma-membrane proton-efflux P-type ...  1775  0.0
 9640.m04351|protein  plasma-membrane proton-efflux P-type ...  1548  0.0
 9635.m00896|protein  plasma-membrane proton-efflux P-type ...  1543  0.0
 9636.m01434|protein  plasma-membrane proton-efflux P-type ...  1514  0.0
 9631.m04701|protein  plasma-membrane proton-efflux P-type ...  1495  0.0
 9630.m05505|protein  plasma-membrane proton-efflux P-type ...  1478  0.0
 9633.m02301|protein  plasma-membrane proton-efflux P-type ...  1436  0.0
 9631.m00012|protein  plasma-membrane proton-efflux P-type ...  1412  0.0
 9634.m00768|protein  plasma-membrane proton-efflux P-type ...  1389  0.0
 9634.m00767|protein  plasma-membrane proton-efflux P-type ...  1388  0.0
 9631.m00801|protein  plasma-membrane proton-efflux P-type ...  1304  0.0
 9639.m02667|protein  E1-E2 ATPase, putative                     357  6e-98
 9639.m02689|protein  E1-E2 ATPase, putative                     313  1e-84
 9629.m07280|protein  hypothetical protein                       203  1e-51
 9640.m00336|protein  calcium-translocating P-type ATPase, ...   195  5e-49
 9633.m03896|protein  calcium-translocating P-type ATPase, ...   191  7e-48
 9631.m00071|protein  E1-E2 ATPase, putative                     182  3e-45
 9636.m04100|protein  calcium-translocating P-type ATPase, ...   176  3e-43
 9630.m00757|protein  calcium-translocating P-type ATPase, ...   174  8e-43
 9631.m00793|protein  AJ315791 SAP-like protein                  167  1e-40

  9632.m05471|protein  plasma-membrane proton-efflux P-type ATPase
            Length = 951
            
 Score = 1775 bits (4548), Expect = 0.0
 Identities = 883/951 (92%), Positives = 923/951 (96%)
 Frame = +2

Query: 161  MGGLEEIRNEAVDLENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKVLK 340
            MGGLEEI+NEAVDLENIPIEEVFEQLKCTR+GL+S+EG +R+E+FG NKLEEKKESK+LK
Sbjct: 1    MGGLEEIKNEAVDLENIPIEEVFEQLKCTREGLSSEEGNRRIEMFGPNKLEEKKESKILK 60

Query: 341  FLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNA 520
            FLGFMWNPLSWVMEMAAIMAIALANGGGKPPDW+DFVGIIVLLVINSTISFIEENNAGNA
Sbjct: 61   FLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNA 120

Query: 521  AAALMANLAPKTKVLRDGRWGEQEASILVPGDIVSIKLGDIVPADARLLEGDPLKIDQSG 700
            AAALMANLAPKTKVLRDGRWGEQEA+ILVPGDI+SIKLGDIVPADARLLEGDPLKIDQS 
Sbjct: 121  AAALMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA 180

Query: 701  LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVL 880
            LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ VL
Sbjct: 181  LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVL 240

Query: 881  TAIGNFCIISIAVGIVIEIIVMFPIQRRKYRAGIENLLVLLIGGIPIAMPTVLSVTMAIG 1060
            TAIGNFCI SIAVGIVIEIIVMFPIQ R YR+GIENLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct: 241  TAIGNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIG 300

Query: 1061 SHKLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLL 1240
            SHKLSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLSVDKNLVEVF KGVDK+HVLL
Sbjct: 301  SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLL 360

Query: 1241 LAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDAEGNWHR 1420
            LAARASR ENQDAIDA MVGMLADPKEARAGIREVHFLPFNP DKRTALTYIDA+GNWHR
Sbjct: 361  LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHR 420

Query: 1421 ASKGAPEQIITLCNCKEDVKRKVHSVIEKYAERGLRSLAVARQEVPEKSKDSAGGPWQFI 1600
            ASKGAPEQI+TLCNCKEDVKRKVH+VI+KYAERGLRSLAVARQEVPEKSK+SAGGPWQF+
Sbjct: 421  ASKGAPEQILTLCNCKEDVKRKVHAVIDKYAERGLRSLAVARQEVPEKSKESAGGPWQFV 480

Query: 1601 GLLPLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ 1780
            GLLPLFDPPRHDSAETIRKAL LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ
Sbjct: 481  GLLPLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ 540

Query: 1781 SKDGSLESLPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKAD 1960
            +KD SLE+LPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKAD
Sbjct: 541  NKDASLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKAD 600

Query: 1961 IGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGF 2140
            IGIAV DATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGF
Sbjct: 601  IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGF 660

Query: 2141 LLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGTYL 2320
            LLIALIWK+DF+PFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKL EIFATG+VLG+YL
Sbjct: 661  LLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYL 720

Query: 2321 ALMTVVFFWIIHRTDFFTNKFGVRSIRENETEKMSALYLQVSIVSQALIFVTRSRSWSFV 2500
            ALMTV+FFW +H+TDFFT+KFGVRSIR +E E MSALYLQVSIVSQALIFVTRSRSWSF+
Sbjct: 721  ALMTVIFFWAMHKTDFFTDKFGVRSIRNSEHEMMSALYLQVSIVSQALIFVTRSRSWSFI 780

Query: 2501 ERPGFLLVIAFLLAQLVATLIAVYANWGFARISGIGWGWAGVIWLFSIVFYFPLDIFKFF 2680
            ERPG LLV AF+LAQLVAT +AVYANWGFARI GIGWGWAGVIWL+SIVFYFPLDIFKFF
Sbjct: 781  ERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFF 840

Query: 2681 IRFVLSGRAWDNLLQNKTAFTTKENYGKGEREAQWATAQRTLHGLQAPEPASHTLFNDKS 2860
            IRFVLSGRAWDNLL+NK AFTTK++YG+ EREAQWATAQRTLHGLQ PE AS+TLFNDKS
Sbjct: 841  IRFVLSGRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKS 900

Query: 2861 SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTINQNYTV 3013
            SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTI QNYTV
Sbjct: 901  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV 951
  9640.m04351|protein  plasma-membrane proton-efflux P-type ATPase
            Length = 956
            
 Score = 1548 bits (3963), Expect = 0.0
 Identities = 764/950 (80%), Positives = 863/950 (90%), Gaps = 4/950 (0%)
 Frame = +2

Query: 164  GGLEEIRNEAVDLENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKVLKF 343
            G L+ +  EAVDLENIP+EEVFE L+C+R+GLT+ +  QR+EIFG NKLEEK+ESK LKF
Sbjct: 6    GNLDAVLKEAVDLENIPLEEVFENLRCSREGLTTQQAQQRLEIFGPNKLEEKEESKFLKF 65

Query: 344  LGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAA 523
            LGFMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAA
Sbjct: 66   LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAA 125

Query: 524  AALMANLAPKTKVLRDGRWGEQEASILVPGDIVSIKLGDIVPADARLLEGDPLKIDQSGL 703
            AALMA LAPK KVLRDGRW E+EA+ILVPGDIVSIKLGDI+PADARLLEGDPLKIDQS L
Sbjct: 126  AALMARLAPKAKVLRDGRWTEEEAAILVPGDIVSIKLGDIIPADARLLEGDPLKIDQSAL 185

Query: 704  TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLT 883
            TGESLPVTK PGD V+SGST KQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQ+VLT
Sbjct: 186  TGESLPVTKGPGDGVYSGSTVKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT 245

Query: 884  AIGNFCIISIAVGIVIEIIVMFPIQRRKYRAGIENLLVLLIGGIPIAMPTVLSVTMAIGS 1063
            AIGNFCI SIAVG+ +EIIVM+PIQ R YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct: 246  AIGNFCICSIAVGMFVEIIVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGS 305

Query: 1064 HKLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLLL 1243
            H+LSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKL+VDKNL++VF +G+ ++ V+L+
Sbjct: 306  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIDVFERGITQDQVILM 365

Query: 1244 AARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDAEGNWHRA 1423
            AARASR ENQDAID  +VGMLADPKEARAGI+EVHFLPFNPTDKRTALTYID +G  +R 
Sbjct: 366  AARASRTENQDAIDTAIVGMLADPKEARAGIQEVHFLPFNPTDKRTALTYIDGDGKMYRV 425

Query: 1424 SKGAPEQIITLCNCKEDVKRKVHSVIEKYAERGLRSLAVARQEVPEKSKDSAGGPWQFIG 1603
            SKGAPEQI+ L + K +++R+VH+VI+K+AERGLRSLAVA QEVPE +K+S GGPW F+G
Sbjct: 426  SKGAPEQILHLAHNKPEIERRVHAVIDKFAERGLRSLAVAYQEVPEGTKESPGGPWHFVG 485

Query: 1604 LLPLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQS 1783
            L+PLFDPPRHDSAETIR+AL LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ+
Sbjct: 486  LMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQN 545

Query: 1784 KDGSLESLPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADI 1963
            KD S+ +LPVD+LIEKADGFAGVFPEHKYEIVKRLQ +KHI GMTGDGVNDAPALKKADI
Sbjct: 546  KDESIAALPVDDLIEKADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADI 605

Query: 1964 GIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFL 2143
            GIAV DATDAARSASDIVLTEPGLSVIISAVLTSR IFQRMKNYTIYAVSITIRIVLGF+
Sbjct: 606  GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM 665

Query: 2144 LIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGTYLA 2323
            L+ALIWKFDF PFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKL EIF TGVVLG YLA
Sbjct: 666  LLALIWKFDFPPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLAEIFTTGVVLGGYLA 725

Query: 2324 LMTVVFFWIIHRTDFFTNKFGVRSIR---ENETEKM-SALYLQVSIVSQALIFVTRSRSW 2491
            +MTV+FFW  ++TDFF   F V S+    +++ +K+ SA+YLQVS +SQALIFVTRSRSW
Sbjct: 726  MMTVIFFWAAYKTDFFPRIFHVESLEKTAQDDFQKLASAVYLQVSTISQALIFVTRSRSW 785

Query: 2492 SFVERPGFLLVIAFLLAQLVATLIAVYANWGFARISGIGWGWAGVIWLFSIVFYFPLDIF 2671
            SFVERPGFLLV AFL+AQL+ATLIAVYA+W F  I GIGWGWAG++WL++++FYFPLDI 
Sbjct: 786  SFVERPGFLLVFAFLVAQLIATLIAVYADWAFTSIKGIGWGWAGIVWLYNLIFYFPLDII 845

Query: 2672 KFFIRFVLSGRAWDNLLQNKTAFTTKENYGKGEREAQWATAQRTLHGLQAPEPASHTLFN 2851
            KF IR+ LSG+AWD +++ + AFT K+++GK ERE +WA AQRTLHGLQ P+     +F+
Sbjct: 846  KFLIRYALSGKAWDLVIEQRIAFTRKKDFGKEERELKWAHAQRTLHGLQPPDA---KMFS 902

Query: 2852 DKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTINQNYTV 3013
            +K+ Y EL+++AE+AKRRAEIARLREL+TLKGHVESVVKLKGLDI+TI Q+YTV
Sbjct: 903  EKAGYNELNQMAEEAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQSYTV 956
  9635.m00896|protein  plasma-membrane proton-efflux P-type ATPase
            Length = 957
            
 Score = 1543 bits (3952), Expect = 0.0
 Identities = 762/948 (80%), Positives = 859/948 (90%), Gaps = 4/948 (0%)
 Frame = +2

Query: 170  LEEIRNEAVDLENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKVLKFLG 349
            LE + NE+VDLENIP+EEVFE L+C R+GLTS    QR+ +FG N+LEEKKESK LKFLG
Sbjct: 8    LEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGPNRLEEKKESKFLKFLG 67

Query: 350  FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA 529
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAAA
Sbjct: 68   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAA 127

Query: 530  LMANLAPKTKVLRDGRWGEQEASILVPGDIVSIKLGDIVPADARLLEGDPLKIDQSGLTG 709
            LMA LAPK KVLR+GRW E+EA+ILVPGDI+S+KLGDI+PADARLLEGDPLKIDQS LTG
Sbjct: 128  LMARLAPKAKVLRNGRWSEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTG 187

Query: 710  ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI 889
            ESLPVTK PGD V+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct: 188  ESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI 247

Query: 890  GNFCIISIAVGIVIEIIVMFPIQRRKYRAGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK 1069
            GNFCI SIA+G+V+EIIVM+PIQ R YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct: 248  GNFCICSIAIGMVVEIIVMYPIQHRDYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR 307

Query: 1070 LSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLLLAA 1249
            L+QQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKL+VDK+L+EVF +GVD++ V+L+AA
Sbjct: 308  LAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFQRGVDQDTVILMAA 367

Query: 1250 RASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDAEGNWHRASK 1429
            RASR ENQDAIDA +VGMLADPKEARAGI+EVHFLPFNPTDKRTALTYID EG  HR SK
Sbjct: 368  RASRTENQDAIDATIVGMLADPKEARAGIQEVHFLPFNPTDKRTALTYIDGEGKMHRVSK 427

Query: 1430 GAPEQIITLCNCKEDVKRKVHSVIEKYAERGLRSLAVARQEVPEKSKDSAGGPWQFIGLL 1609
            GAPEQI+ L + K +++R+V +VI+K+AERGLRSL VA Q+VP+  K+S GGPWQF+GLL
Sbjct: 428  GAPEQILNLAHNKTEIERRVRAVIDKFAERGLRSLGVAYQQVPDGRKESPGGPWQFVGLL 487

Query: 1610 PLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQSKD 1789
            PLFDPPRHDSAETIR+AL LGVNVKMITGDQLAIGKET RRLGMGTNMYPSSALLGQ KD
Sbjct: 488  PLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETARRLGMGTNMYPSSALLGQDKD 547

Query: 1790 GSLESLPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGI 1969
             S+ +LPVDELIEKADGFAGVFPEHKYEIVKRLQ +KHI GMTGDGVNDAPALKKADIGI
Sbjct: 548  ESIVALPVDELIEKADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGI 607

Query: 1970 AVDDATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFLLI 2149
            AVDD+TDAARSASDIVLTEPGLSVIISAVLTSR IFQRMKNYTIYAVSITIRIVLGF+L+
Sbjct: 608  AVDDSTDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLL 667

Query: 2150 ALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGTYLALM 2329
            ALIWKFDF PFMVLIIAILNDGTIMTISKDRVKPSP PDSWKL+EIFATGVVLG+YLA+M
Sbjct: 668  ALIWKFDFPPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLSEIFATGVVLGSYLAMM 727

Query: 2330 TVVFFWIIHRTDFFTNKFGVRSIR---ENETEKM-SALYLQVSIVSQALIFVTRSRSWSF 2497
            TV+FFW+ ++TDFF   F V S+    +++ +K+ SA+YLQVS +SQALIFVTRSRSWSF
Sbjct: 728  TVIFFWVAYKTDFFPRVFHVESLEKTAQDDFQKLASAVYLQVSTISQALIFVTRSRSWSF 787

Query: 2498 VERPGFLLVIAFLLAQLVATLIAVYANWGFARISGIGWGWAGVIWLFSIVFYFPLDIFKF 2677
            VERPGFLLV AF +AQL+ATLIAVYANWGFA I GIGWGWAGVIWL++IVFY PLDI KF
Sbjct: 788  VERPGFLLVFAFFVAQLIATLIAVYANWGFASIKGIGWGWAGVIWLYNIVFYLPLDIIKF 847

Query: 2678 FIRFVLSGRAWDNLLQNKTAFTTKENYGKGEREAQWATAQRTLHGLQAPEPASHTLFNDK 2857
             IR+ LSGRAWD +L+ + AFT K+++G  E + +WATAQRT+HGLQ    A+  +F D 
Sbjct: 848  LIRYALSGRAWDLVLEQRIAFTRKKDFGTQENQLKWATAQRTIHGLQ--PAATAAVFRDM 905

Query: 2858 SSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTINQNYTV 3013
            +SY +L+++AE+A+RRAEIARLREL TLKG +ESVVK KGLD++TI Q+YTV
Sbjct: 906  TSYNDLNQLAEEARRRAEIARLRELTTLKGRMESVVKQKGLDLETIQQSYTV 957
  9636.m01434|protein  plasma-membrane proton-efflux P-type ATPase
            Length = 954
            
 Score = 1514 bits (3876), Expect = 0.0
 Identities = 748/953 (78%), Positives = 848/953 (88%), Gaps = 4/953 (0%)
 Frame = +2

Query: 155  SAMGGLEEIRNEAVDLENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKV 334
            S    LE+I+NEAVDLE+IP+EEVF+ LKCTR+GLT+ EG  R ++FG NKLEEKKESK+
Sbjct: 7    STADALEQIKNEAVDLEHIPLEEVFQHLKCTREGLTNAEGDARTQVFGPNKLEEKKESKI 66

Query: 335  LKFLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAG 514
            LKFLGFMWNPLSWVME+AAIMAIALANGGG+PPDWQDFVGII LL+INSTIS+ EE+NAG
Sbjct: 67   LKFLGFMWNPLSWVMEVAAIMAIALANGGGRPPDWQDFVGIIALLLINSTISYWEESNAG 126

Query: 515  NAAAALMANLAPKTKVLRDGRWGEQEASILVPGDIVSIKLGDIVPADARLLEGDPLKIDQ 694
            +AAAALM NLAPKTKVLRDGRW E +A +LVPGD++++KLGDIVPADARLL+GDPLKIDQ
Sbjct: 127  SAAAALMKNLAPKTKVLRDGRWSETDAFVLVPGDVINVKLGDIVPADARLLDGDPLKIDQ 186

Query: 695  SGLTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQ 874
            S LTGESLPVTK PGD V+SGSTCKQGEI+AVVIATGVHTFFGKAAHLVD+TNQVGHFQ+
Sbjct: 187  SALTGESLPVTKLPGDCVYSGSTCKQGEIDAVVIATGVHTFFGKAAHLVDTTNQVGHFQK 246

Query: 875  VLTAIGNFCIISIAVGIVIEIIVMFPIQRRKYRAGIENLLVLLIGGIPIAMPTVLSVTMA 1054
            VL AIGNFCI +IA+G+ +E+IVM+ IQ R YR GI+NLLVLLIGGIPIAMPTVLSVTMA
Sbjct: 247  VLRAIGNFCIGAIAIGMAVEVIVMYLIQHRLYRDGIDNLLVLLIGGIPIAMPTVLSVTMA 306

Query: 1055 IGSHKLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHV 1234
            IGSH+LS QGAITKRMTAIEE+A MDVLCSDKTGTLTLNKLSVD+ L+EVF +GV K+ V
Sbjct: 307  IGSHRLSDQGAITKRMTAIEEMAAMDVLCSDKTGTLTLNKLSVDRGLIEVFVQGVAKDEV 366

Query: 1235 LLLAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYID-AEGN 1411
            +LL ARASRVENQDAID  MVGML DPKEARAGIRE HFLPFNP DKRTALTY+D A+G+
Sbjct: 367  ILLTARASRVENQDAIDTAMVGMLDDPKEARAGIREEHFLPFNPVDKRTALTYVDLADGS 426

Query: 1412 WHRASKGAPEQIITLCNCKEDVKRKVHSVIEKYAERGLRSLAVARQEVPEKSKDSAGGPW 1591
            WHR        I+ LC C++DV+ KVH++I++YA+RGLRSLAVARQEVPE+ KD  GGPW
Sbjct: 427  WHR--------ILDLCKCRQDVRSKVHAIIDRYADRGLRSLAVARQEVPERRKDGPGGPW 478

Query: 1592 QFIGLLPLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSAL 1771
            +F+GLLPL DPPRHDSAETIR+AL LGVNVKMITGDQLAI KETGRRLGMG NMYPSSAL
Sbjct: 479  EFVGLLPLLDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGVNMYPSSAL 538

Query: 1772 LGQSKDGSLESLPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALK 1951
            LGQSKD S+ S+PVDELI+KADGFAGVFPEHKYEIVK+LQE KHI GMTGDGVNDAPALK
Sbjct: 539  LGQSKDESIASVPVDELIKKADGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALK 598

Query: 1952 KADIGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIV 2131
            +ADIGIAV DATDAARSASDIVLT+PGLSVIISAVLTSR IFQRMKNYTIYAVSITIRIV
Sbjct: 599  RADIGIAVADATDAARSASDIVLTQPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV 658

Query: 2132 LGFLLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLG 2311
            LGF+LIALIWKFDF+PFM+L+IAILNDGTIMTISKDRVKPSP PDSWKL EIF TG+V G
Sbjct: 659  LGFMLIALIWKFDFSPFMILVIAILNDGTIMTISKDRVKPSPHPDSWKLPEIFITGIVYG 718

Query: 2312 TYLALMTVVFFWIIHRTDFFTNKFGVRSIRENETEKMSALYLQVSIVSQALIFVTRSRSW 2491
            TYLA+MTV+FFW +  TDFFT+ F V+ + E + E MSALYLQVSI+SQALIFVTRSRSW
Sbjct: 719  TYLAVMTVLFFWAMRSTDFFTSTFHVKPLMEKD-EMMSALYLQVSIISQALIFVTRSRSW 777

Query: 2492 SFVERPGFLLVIAFLLAQLVATLIAVYANWGFARISGIGWGWAGVIWLFSIVFYFPLDIF 2671
             FVERPG LL  AF+ AQ++ATL+ VYA  GFA I GIGWGWAGVIWL+SIV + PLDIF
Sbjct: 778  CFVERPGMLLCGAFVAAQIIATLVTVYATLGFAHIKGIGWGWAGVIWLYSIVTFLPLDIF 837

Query: 2672 KFFIRFVLSGRAWDNLLQNKTAFTTKENYGKGEREAQWATAQRTLHGLQAPEPASH---T 2842
            KF +R+ LSGRAWD L+++K AFT+K++YG+GEREAQWATAQRTLHGLQ PE   H    
Sbjct: 838  KFAVRYALSGRAWDTLIEHKIAFTSKKDYGRGEREAQWATAQRTLHGLQTPEMGDHLGGV 897

Query: 2843 LFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTINQNYTV 3013
               ++SSYRELSEIAEQAKRRAE+ARLREL+TLKG +ES V+LKGLD+D +  +YTV
Sbjct: 898  GGGERSSYRELSEIAEQAKRRAEVARLRELSTLKGQMESTVRLKGLDMDNVQHHYTV 954
  9631.m04701|protein  plasma-membrane proton-efflux P-type ATPase
            Length = 1000
            
 Score = 1495 bits (3828), Expect = 0.0
 Identities = 757/950 (79%), Positives = 855/950 (89%), Gaps = 48/950 (5%)
 Frame = +2

Query: 164  GGLEEIRNEAVDL--ENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKVL 337
            GGL+ +  E+VDL  ENIPIEEVF+ LKC RQGLTS+E   R+++FG NKLEEK+ESK L
Sbjct: 6    GGLDAVLKESVDLVLENIPIEEVFQNLKCCRQGLTSEEAQLRLQLFGPNKLEEKEESKFL 65

Query: 338  KFLGFMWNPLSWVMEMAAIMAIALANGGG---KPPDWQDFVGIIVLLVINSTISFIEENN 508
            KFLGFMWNPLSWVME AAIMAIALANGGG   KPPDWQDFVGII LL+INSTISFIEENN
Sbjct: 66   KFLGFMWNPLSWVMEAAAIMAIALANGGGNCGKPPDWQDFVGIITLLLINSTISFIEENN 125

Query: 509  AGNAAAALMANLAPKTKVLRDGRWGEQEASILVPGDIVSIKLGDIVPADARLLEGDPLKI 688
            AGNAAAALMA LAPK KVLR+G W E+EA+ILVPGDI+SIKLGDI+PADARLLEGDPLKI
Sbjct: 126  AGNAAAALMARLAPKAKVLRNGSWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKI 185

Query: 689  DQSGLTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF 868
            DQS LTGESLP TK PGD V+SGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct: 186  DQSALTGESLPATKGPGDGVYSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF 245

Query: 869  QQ----------VLTAIGNFCIISIAVGIVIEIIVMFPIQRRKYRAGIENLLVLLIGGIP 1018
            Q+          VLTAIGNFCI SIAVG+ +EIIVM+PIQ R YR GI+NLLVLLIGGIP
Sbjct: 246  QKARLRSLTSVHVLTAIGNFCICSIAVGMFVEIIVMYPIQHRPYRPGIDNLLVLLIGGIP 305

Query: 1019 IAMPTVLSVTMAIGSHKLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLV 1198
            IAMPTVLSVTMAIGSH+LSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKL+VDKNL+
Sbjct: 306  IAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLI 365

Query: 1199 EVFAKGVDKEHVLLLAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPTDKR 1378
            E+F +GV ++ V+L+AARASR ENQDAID  +VGMLADPKEARAGI+EVHFLPFNPTDKR
Sbjct: 366  EIFERGVTQDQVILMAARASRTENQDAIDTAIVGMLADPKEARAGIQEVHFLPFNPTDKR 425

Query: 1379 TALTYIDAEGNWHRASKGAPEQIITLCNCKEDVKRKVHSVIEKYAERGLRSLAVARQEVP 1558
            TALTYID++G  +R SKGAPEQI+ L + K  ++R+VH+VI+K+AERGLRSLAVA QEVP
Sbjct: 426  TALTYIDSDGKMYRVSKGAPEQILNLAHNKTQIERRVHAVIDKFAERGLRSLAVAYQEVP 485

Query: 1559 EKSKDSAGGPWQFIGLLPLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLG 1738
            +  K+S GGPW+F+ LLPLFDPPRHDSAETIR+AL LGVNVKMITGDQLAIGKETGRRLG
Sbjct: 486  DGRKESPGGPWRFVALLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLG 545

Query: 1739 MGTNMYPSSALLGQSKDGSLESLPVDELIEKADGFAGVFP-------------------- 1858
            MGTNMYPSSALLGQ+KD S+ +LPVD+LIEKADGFAGVFP                    
Sbjct: 546  MGTNMYPSSALLGQNKDESVAALPVDDLIEKADGFAGVFPGLYAINCRIKTKWLKVTKKN 605

Query: 1859 ---------EHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGIAVDDATDAARSASD 2011
                     EHKYEIVKRLQ +KHI GMTGDGVNDAPALKKADIGIAV DATDAARSASD
Sbjct: 606  ITVKFSLFSEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASD 665

Query: 2012 IVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFAPFMVL 2191
            IVLTEPGLSVIISAVLTSR IFQRMKNYTIYAVSITIRIV GF+L+ALIW+FDF PFMVL
Sbjct: 666  IVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLLALIWEFDFPPFMVL 725

Query: 2192 IIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGTYLALMTVVFFWIIHRTDFF 2371
            IIAILNDGTIMTISKD VKPSPLPDSWKL EIF TGVVLG YLA+MTV+FFW  ++T+FF
Sbjct: 726  IIAILNDGTIMTISKDLVKPSPLPDSWKLAEIFTTGVVLGGYLAMMTVIFFWAAYKTNFF 785

Query: 2372 TNKFGVRSIR---ENETEKM-SALYLQVSIVSQALIFVTRSRSWSFVERPGFLLVIAFLL 2539
               F V S+    +++ +K+ SA+YLQVS +SQALIFVTRSRSWSF+ERPGFLLV AF +
Sbjct: 786  PRIFHVESLEKTAQDDYQKLASAVYLQVSTISQALIFVTRSRSWSFIERPGFLLVFAFFV 845

Query: 2540 AQLVATLIAVYANWGFARISGIGWGWAGVIWLFSIVFYFPLDIFKFFIRFVLSGRAWDNL 2719
            AQL+ATLIAVYANW F  I GIGWGWAG++WL+++VFYFPLDI KF IR+ LSG+AWD +
Sbjct: 846  AQLIATLIAVYANWAFTSIKGIGWGWAGIVWLYNLVFYFPLDIIKFLIRYALSGKAWDLV 905

Query: 2720 LQNKTAFTTKENYGKGEREAQWATAQRTLHGLQAPEPASHTLFNDKSSYRELSEIAEQAK 2899
            ++ + AFT K+++GK ERE +WA A RTLHGLQ P+      F +K+ Y EL+++AE+AK
Sbjct: 906  IEQRIAFTRKKDFGKEERELKWAHAHRTLHGLQPPDAKP---FPEKTGYSELNQMAEEAK 962

Query: 2900 RRAEIARLRELNTLKGHVESVVKLKGLDIDTINQNYTV 3013
            RRAEIARLREL+TLKGHVESVVKLKGLDIDTI+Q+YTV
Sbjct: 963  RRAEIARLRELHTLKGHVESVVKLKGLDIDTIHQSYTV 1000
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 220200204 Number of Sequences: 59712 Number of extensions: 6320908 Number of successful extensions: 31946 Number of sequences better than 1.0e-10: 58 Number of HSP's better than 0.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 18 Number of HSP's that attempted gapping in prelim test: 31768 Number of HSP's gapped (non-prelim): 93 length of query: 1137 length of database: 26,991,925 effective HSP length: 54 effective length of query: 1082 effective length of database: 23,767,477 effective search space: 25716410114 effective search space used: 25716410114 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 163 (67.9 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG681   Members:163            3pri:Y   1e-134      
AAN86274.1       non-cell-autonomous heat shock cognate protein 70
[Cucurbita maxima]
         (2288 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9639.m04467|protein  dnaK-type molecular chaperone hsp70 -...  1235  0.0
 9631.m05972|protein  heat shock protein cognate 70             1226  0.0
 9633.m03578|protein  dnaK protein                              1215  0.0
 9629.m06146|protein  dnaK protein                              1215  0.0
 9631.m01647|protein  dnaK protein                              1215  0.0
 9631.m01656|protein  heat shock cognate 70 kda protein         1160  0.0
 9639.m04468|protein  dnaK-type molecular chaperone hsp70 -...  1125  0.0
 9633.m03577|protein  dnaK protein                              1049  0.0
 9630.m00144|protein  dnaK-type molecular chaperone BiP - rice   829  0.0
 9631.m04907|protein  putative luminal binding protein           779  0.0
 9633.m03294|protein  luminal binding protein 5 precursor (...   778  0.0
 9631.m01650|protein  dnaK protein                               776  0.0
 9636.m04621|protein  BiP-isoform D                              764  0.0
 9633.m02768|protein  luminal binding protein 4 precursor (...   736  0.0
 9639.m00793|protein  dnaK protein, putative                     643  0.0
 9629.m04774|protein  dnaK protein                               571  e-162
 9639.m00795|protein  Similar to dnaK-type molecular chaper...   569  e-162
 9630.m05282|protein  dnaK protein                               563  e-160
 9631.m00134|protein  dnaK protein                               559  e-159
 9639.m00796|protein  Similar to hsp70                           554  e-157

  9639.m04467|protein  dnaK-type molecular chaperone hsp70 - rice
            (fragment)
            Length = 649
            
 Score = 1235 bits (3161), Expect = 0.0
 Identities = 614/647 (94%), Positives = 635/647 (97%), Gaps = 2/647 (0%)
 Frame = +2

Query: 131  MAAKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN 310
            MA KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDSERLIGDAAKN
Sbjct: 1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN 60

Query: 311  QVAMNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAA 490
            QVAMNPINTVFDAKRLIGRRF+D++VQSDIKLWPFKV+AGPGDKPMI VQYKGEEKQFAA
Sbjct: 61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA 120

Query: 491  EEISSMVLIKMREIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP 670
            EEISSMVLIKMREIAEA+LGTT+KNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEP
Sbjct: 121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP 180

Query: 671  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 850
            TAAAIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
Sbjct: 181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240

Query: 851  NRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGIDFY 1030
            NRMVNHFVQEFKRKNKKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGIDFY
Sbjct: 241  NRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY 300

Query: 1031 STITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFF 1210
            STITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPRVQQLLQDFF
Sbjct: 301  STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQDFF 360

Query: 1211 NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI 1390
            NGKELCK+INPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
Sbjct: 361  NGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI 420

Query: 1391 PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI 1570
            PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
Sbjct: 421  PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI 480

Query: 1571 TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK 1750
            TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK
Sbjct: 481  TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK 540

Query: 1751 KVESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEEAIDAAIQWLDANQLAEADEFED 1930
            KVESKNALENY+YNMRNTIKDEKIASKLPA DKKKIE+AID AIQWLD NQLAEADEF+D
Sbjct: 541  KVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDD 600

Query: 1931 KMKELEALCNPIIAKMYQGAGADMEGGMDDD--TPAASGGAGPKIEEVD 2071
            KMKELE +CNPIIAKMYQGAGADM GGMD+D   PA   GAGPKIEEVD
Sbjct: 601  KMKELEGICNPIIAKMYQGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD 649
  9631.m05972|protein  heat shock protein cognate 70
            Length = 649
            
 Score = 1226 bits (3137), Expect = 0.0
 Identities = 606/644 (94%), Positives = 634/644 (98%), Gaps = 1/644 (0%)
 Frame = +2

Query: 140  KGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA 319
            KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVA
Sbjct: 5    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA 64

Query: 320  MNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAAEEI 499
            MNPINTVFDAKRLIGRRF+D++VQSDIK+WP+KV+ GPGDKPMI VQYKGEEKQF+AEEI
Sbjct: 65   MNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEI 124

Query: 500  SSMVLIKMREIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEPTAA 679
            SSMVLIKMREIAEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEPTAA
Sbjct: 125  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA 184

Query: 680  AIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRM 859
            AIAYGLDKKA+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR+
Sbjct: 185  AIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL 244

Query: 860  VNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGIDFYSTI 1039
            VNHFVQEFKRK+KKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEG+DFYSTI
Sbjct: 245  VNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGVDFYSTI 304

Query: 1040 TRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFFNGK 1219
            TRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFFNGK
Sbjct: 305  TRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFFNGK 364

Query: 1220 ELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRN 1399
            ELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRN
Sbjct: 365  ELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRN 424

Query: 1400 TTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVC 1579
            TTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVC
Sbjct: 425  TTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVC 484

Query: 1580 FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVE 1759
            FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYKSEDEEHKKKV+
Sbjct: 485  FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVD 544

Query: 1760 SKNALENYSYNMRNTIKDEKIASKLPADDKKKIEEAIDAAIQWLDANQLAEADEFEDKMK 1939
            +KN+LENY+YNMRNTI+DEKIASKLPADDKKKIE+A++ AIQWLD NQLAE +EFEDKMK
Sbjct: 545  AKNSLENYAYNMRNTIQDEKIASKLPADDKKKIEDAVEQAIQWLDNNQLAEVEEFEDKMK 604

Query: 1940 ELEALCNPIIAKMYQGAGADMEGGMDDDTPAASG-GAGPKIEEVD 2071
            ELE LCNPIIAKMYQGAGADM GGMDDD PAA G GAGPKIEEVD
Sbjct: 605  ELEGLCNPIIAKMYQGAGADMGGGMDDDAPAAGGSGAGPKIEEVD 649
  9633.m03578|protein  dnaK protein
            Length = 646
            
 Score = 1215 bits (3109), Expect = 0.0
 Identities = 599/645 (92%), Positives = 627/645 (96%)
 Frame = +2

Query: 137  AKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV 316
            +KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQV
Sbjct: 2    SKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 61

Query: 317  AMNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAAEE 496
            AMNP NTVFDAKRLIGRRF+D +VQSD+KLWPFKVV GPGDKPMI VQYKGEEKQFAAEE
Sbjct: 62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAEE 121

Query: 497  ISSMVLIKMREIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEPTA 676
            ISSMVLIKMREIAEA+LG+++KNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEPTA
Sbjct: 122  ISSMVLIKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA 181

Query: 677  AAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR 856
            AAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct: 182  AAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR 241

Query: 857  MVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGIDFYST 1036
            MVNHFVQEFKRKNKKDISGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGIDFY+T
Sbjct: 242  MVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTT 301

Query: 1037 ITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFFNG 1216
            ITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQDFFNG
Sbjct: 302  ITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNG 361

Query: 1217 KELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPR 1396
            KELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPR
Sbjct: 362  KELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPR 421

Query: 1397 NTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITV 1576
            NTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQI V
Sbjct: 422  NTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQINV 481

Query: 1577 CFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKV 1756
            CFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDEEHKKKV
Sbjct: 482  CFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKV 541

Query: 1757 ESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEEAIDAAIQWLDANQLAEADEFEDKM 1936
            ++KNALENY+YNMRNTIKDEKIASKL ADDKK+IE+AID AI WLD NQLAEADEFEDKM
Sbjct: 542  DAKNALENYAYNMRNTIKDEKIASKLAADDKKRIEDAIDGAISWLDTNQLAEADEFEDKM 601

Query: 1937 KELEALCNPIIAKMYQGAGADMEGGMDDDTPAASGGAGPKIEEVD 2071
            KELE +CNPIIAKMYQG GADM GGMD+D PA   GAGPKIEEVD
Sbjct: 602  KELEGICNPIIAKMYQGPGADMAGGMDEDAPAGGSGAGPKIEEVD 646
  9629.m06146|protein  dnaK protein
            Length = 648
            
 Score = 1215 bits (3109), Expect = 0.0
 Identities = 602/645 (93%), Positives = 630/645 (97%), Gaps = 2/645 (0%)
 Frame = +2

Query: 137  AKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV 316
            AKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV
Sbjct: 2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV 61

Query: 317  AMNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAAEE 496
            AMNPINTVFDAKRLIGRRF+D +VQSD+KLWPFKV+ GPGDKPMI VQYKGEEKQF+AEE
Sbjct: 62   AMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEE 121

Query: 497  ISSMVLIKMREIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEPTA 676
            ISSMVLIKMREIAEA+LG+ +KNAVVTVPAYFNDSQRQATKDAGVIAG+NV+RIINEPTA
Sbjct: 122  ISSMVLIKMREIAEAYLGSNIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTA 181

Query: 677  AAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR 856
            AAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct: 182  AAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR 241

Query: 857  MVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGIDFYST 1036
            MVNHFV EFKRKNKKDISGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGIDFYST
Sbjct: 242  MVNHFVLEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYST 301

Query: 1037 ITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFFNG 1216
            ITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQDFFNG
Sbjct: 302  ITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNG 361

Query: 1217 KELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPR 1396
            KELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPR
Sbjct: 362  KELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPR 421

Query: 1397 NTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITV 1576
            NTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITV
Sbjct: 422  NTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITV 481

Query: 1577 CFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKV 1756
            CFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+EDEEHKKKV
Sbjct: 482  CFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKV 541

Query: 1757 ESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEEAIDAAIQWLDANQLAEADEFEDKM 1936
            ++KNALENY+YNMRNTIKD+KIASKL ADDKKKIE+AID AI WLD+NQLAEADEFEDKM
Sbjct: 542  DAKNALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIDGAINWLDSNQLAEADEFEDKM 601

Query: 1937 KELEALCNPIIAKMYQGAGADMEG--GMDDDTPAASGGAGPKIEEVD 2071
            KELE++CNPIIAKMYQGAGADM G  GMD+D PA   GAGPKIEEVD
Sbjct: 602  KELESICNPIIAKMYQGAGADMGGAAGMDEDAPAGGSGAGPKIEEVD 648
  9631.m01647|protein  dnaK protein
            Length = 650
            
 Score = 1215 bits (3108), Expect = 0.0
 Identities = 600/647 (92%), Positives = 633/647 (97%), Gaps = 3/647 (0%)
 Frame = +2

Query: 131  MAAKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN 310
            MA KGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
Sbjct: 1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN 60

Query: 311  QVAMNPINTVFDAKRLIGRRFTDSTVQSDIKLWPFKVVAGPGDKPMINVQYKGEEKQFAA 490
            QVAMNPINTVFDAKRLIGRRF+D++VQSD KLWPFKV+ GPGDKPMI VQYKGEEKQF+A
Sbjct: 61   QVAMNPINTVFDAKRLIGRRFSDTSVQSDAKLWPFKVLPGPGDKPMIGVQYKGEEKQFSA 120

Query: 491  EEISSMVLIKMREIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP 670
            EEISSMVL KM+E AEA+LG+TVKNAVVTVPAYFNDSQRQATKDAGVI+G+NV+RIINEP
Sbjct: 121  EEISSMVLNKMKETAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP 180

Query: 671  TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 850
            TAAAIAYGLDKK+SSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
Sbjct: 181  TAAAIAYGLDKKSSSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240

Query: 851  NRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGIDFY 1030
            NRMVNHFVQEFKRKNKKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSL+EGIDFY
Sbjct: 241  NRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY 300

Query: 1031 STITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFF 1210
            +TITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFF
Sbjct: 301  TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFF 360

Query: 1211 NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI 1390
            NGKELCKSINPDEAVAYGAAVQAAIL+GEGNEKVQDLLLLDVTPLS GLETAGGVMTVLI
Sbjct: 361  NGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLI 420

Query: 1391 PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI 1570
            PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRT+DNNLLGKFELSGIPPAPRGVPQI
Sbjct: 421  PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQI 480

Query: 1571 TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK 1750
            TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK+EDEEHKK
Sbjct: 481  TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKK 540

Query: 1751 KVESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEEAIDAAIQWLDANQLAEADEFED 1930
            KV++KN+LENY+YNMRNTIKD+KIASKLP  DKKKIE+AID AI WLD+NQLAEA+EFED
Sbjct: 541  KVDAKNSLENYAYNMRNTIKDDKIASKLPEADKKKIEDAIDGAISWLDSNQLAEAEEFED 600

Query: 1931 KMKELEALCNPIIAKMYQGAGADMEGGMDDDTPAASGGA---GPKIEEVD 2071
            KMKELE +CNPIIAKMYQGAGADM GGMD+D PAA+GG+   GPKIEEVD
Sbjct: 601  KMKELEGVCNPIIAKMYQGAGADMAGGMDEDAPAAAGGSSGPGPKIEEVD 650
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 158082169 Number of Sequences: 59712 Number of extensions: 5037548 Number of successful extensions: 60242 Number of sequences better than 1.0e-10: 53 Number of HSP's better than 0.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 60064 Number of HSP's gapped (non-prelim): 54 length of query: 762 length of database: 26,991,925 effective HSP length: 53 effective length of query: 709 effective length of database: 23,827,189 effective search space: 16893477001 effective search space used: 16893477001 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 162 (67.5 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG685   Members:125            3pri:Y   1e-131      
CAE01288.1       OSJNBa0020P07.5 [Oryza sativa (japonica
cultivar-group)]
         (2872 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9630.m03028|protein  AF367331 At1g56070/T6H22_13               1637  0.0
 9632.m00189|protein  Elongation factor G, domain IV, putative  1631  0.0
 9629.m05250|protein  Elongation factor G, domain IV, putative  1530  0.0
 9629.m05092|protein  Elongation factor G, domain IV, putative  1375  0.0
 9634.m03897|protein  Elongation factor G, domain IV, putative   615  e-176
 9630.m03217|protein  Similar to elongation factor EF-2          329  2e-89
 9631.m04330|protein  putative translation elongation factor     309  2e-83
 9631.m03522|protein  translation elongation factor G            136  2e-31
 9634.m00447|protein  Similar to GTP-binding membrane prote...   107  9e-23
 9630.m01743|protein  Elongation factor Tu GTP binding doma...   104  1e-21
 9632.m04375|protein  translation elongation factor G            101  5e-21
 9630.m00559|protein  Similar to GTP-binding protein LepA h...   100  2e-20
 9629.m05356|protein  Elongation factor Tu GTP binding doma...    97  1e-19

  9630.m03028|protein  AF367331 At1g56070/T6H22_13
            Length = 843
            
 Score = 1637 bits (4193), Expect = 0.0
 Identities = 801/843 (95%), Positives = 826/843 (97%)
 Frame = +1

Query: 25   MVKFTAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 204
            MVKFT EELR IMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR
Sbjct: 1    MVKFTVEELRRIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 60

Query: 205  ADEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALR 384
            ADEAERGITIKSTGISLFY+M+ ESL++YKG+RDG+EYLINLIDSPGHVDFSSEVTAALR
Sbjct: 61   ADEAERGITIKSTGISLFYEMSDESLKLYKGERDGNEYLINLIDSPGHVDFSSEVTAALR 120

Query: 385  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR 564
            ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR
Sbjct: 121  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR 180

Query: 565  VIENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDEAKM 744
            VIENANVIMATYED LLGDVQVYPEKGTVAFSAGLHGWAFTL++FAKMYASKFGVDE KM
Sbjct: 181  VIENANVIMATYEDTLLGDVQVYPEKGTVAFSAGLHGWAFTLSSFAKMYASKFGVDEFKM 240

Query: 745  MERLWGENFFDPATKKWTSKNTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPMLKK 924
            MERLWGENFFDPATKKWT+KNTG+ATCKRGFVQFCYEPIKQII TCMNDQKDKLWPML+K
Sbjct: 241  MERLWGENFFDPATKKWTNKNTGSATCKRGFVQFCYEPIKQIINTCMNDQKDKLWPMLQK 300

Query: 925  LGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGPLD 1104
            LGV MK DEK+LMGKALMKRVMQTWLPAS ALLEMMI+HLPSPSKAQRYRVENLYEGPLD
Sbjct: 301  LGVVMKADEKELMGKALMKRVMQTWLPASNALLEMMIYHLPSPSKAQRYRVENLYEGPLD 360

Query: 1105 DIYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVPGQ 1284
            D+YA AIRNCDP+GPLMLYVSKMIPASDKGRFFAFGRVF+GRVATGMKVRIMGPN+VPGQ
Sbjct: 361  DVYATAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGRVATGMKVRIMGPNYVPGQ 420

Query: 1285 KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEKEVDACPIRA 1464
            KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVA+VGLDQFITKNATLTNEKE DACPIRA
Sbjct: 421  KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVAMVGLDQFITKNATLTNEKESDACPIRA 480

Query: 1465 MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI 1644
            MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI
Sbjct: 481  MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI 540

Query: 1645 CLKDLQDDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 1824
            CLKDLQ+DFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE
Sbjct: 541  CLKDLQEDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 600

Query: 1825 AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 2004
            AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI
Sbjct: 601  AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 660

Query: 2005 KDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHTDAIHRGGGQVIPTARRVIYASQLT 2184
            KDSVVAGFQWASKEGALAEENMRGICFEVCDVVLH DAIHRGGGQVIPTARRVIYASQLT
Sbjct: 661  KDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLT 720

Query: 2185 AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRQGTPLYNIKAYLPVIESFG 2364
            AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQR GTPLYNIKAYLPVIESFG
Sbjct: 721  AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFG 780

Query: 2365 FSSTLRAATSGQAFPQCVFDHWDIMASDPLDPGTQSATLVTEIRKRKGLKEQMTPLSDFE 2544
            FSS LRAATSGQAFPQCVFDHWD+M SDPL+ G+Q++TLV +IRKRKGLKEQMTPLSDFE
Sbjct: 781  FSSQLRAATSGQAFPQCVFDHWDMMTSDPLEAGSQASTLVQDIRKRKGLKEQMTPLSDFE 840

Query: 2545 DKL 2553
            DKL
Sbjct: 841  DKL 843
  9632.m00189|protein  Elongation factor G, domain IV, putative
            Length = 843
            
 Score = 1631 bits (4178), Expect = 0.0
 Identities = 798/843 (94%), Positives = 824/843 (97%)
 Frame = +1

Query: 25   MVKFTAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 204
            MVKFT EELR IMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR
Sbjct: 1    MVKFTVEELRRIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 60

Query: 205  ADEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALR 384
            ADEAERGITIKSTGISLFY+M+ ESL++YKG+RDG+EYLINLIDSPGHVDFSSEVTAALR
Sbjct: 61   ADEAERGITIKSTGISLFYEMSDESLKLYKGERDGNEYLINLIDSPGHVDFSSEVTAALR 120

Query: 385  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR 564
            ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR
Sbjct: 121  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR 180

Query: 565  VIENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDEAKM 744
            VIENANVIMATYED LLGDVQVYPEKGTVAFSAGLHGWAFTL++FAKMYASKFGVDE+KM
Sbjct: 181  VIENANVIMATYEDTLLGDVQVYPEKGTVAFSAGLHGWAFTLSSFAKMYASKFGVDESKM 240

Query: 745  MERLWGENFFDPATKKWTSKNTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPMLKK 924
            MERLWGENFFDPATKKWT+K+TG+ATCKRGFVQFCYEPIKQII TCMNDQKDKLWPML+K
Sbjct: 241  MERLWGENFFDPATKKWTNKSTGSATCKRGFVQFCYEPIKQIINTCMNDQKDKLWPMLQK 300

Query: 925  LGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGPLD 1104
            LGV MK DEKDLMGKALMKRVMQTWLPAS ALLEMMI+HLPSPSKAQ+YRVENLYEGPLD
Sbjct: 301  LGVVMKADEKDLMGKALMKRVMQTWLPASNALLEMMIYHLPSPSKAQKYRVENLYEGPLD 360

Query: 1105 DIYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVPGQ 1284
            D+YA AIRNCDP+GPLMLYVSKMIPASDKGRFFAFGRVF+GRVATGMKVRIMGPN+VPGQ
Sbjct: 361  DVYATAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGRVATGMKVRIMGPNYVPGQ 420

Query: 1285 KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEKEVDACPIRA 1464
            KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVA+VGLDQFITKNATLTNEKE DACPIRA
Sbjct: 421  KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVAMVGLDQFITKNATLTNEKEADACPIRA 480

Query: 1465 MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI 1644
            MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI
Sbjct: 481  MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI 540

Query: 1645 CLKDLQDDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 1824
            CLKDLQ+DFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE
Sbjct: 541  CLKDLQEDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 600

Query: 1825 AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 2004
            AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI
Sbjct: 601  AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 660

Query: 2005 KDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHTDAIHRGGGQVIPTARRVIYASQLT 2184
            KDSVVAGFQWASKEGALAEENMRGICFEVCDVVLH DAIHRGGGQVIPTARRVIYASQLT
Sbjct: 661  KDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLT 720

Query: 2185 AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRQGTPLYNIKAYLPVIESFG 2364
            AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQR GTPLYNIKAYLPVIESFG
Sbjct: 721  AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFG 780

Query: 2365 FSSTLRAATSGQAFPQCVFDHWDIMASDPLDPGTQSATLVTEIRKRKGLKEQMTPLSDFE 2544
            FSS LRAATSGQAFPQCVFDHWD+M SDPL+  +Q+  LV +IRKRKGLKEQMTPLSDFE
Sbjct: 781  FSSQLRAATSGQAFPQCVFDHWDMMTSDPLEVSSQANQLVLDIRKRKGLKEQMTPLSDFE 840

Query: 2545 DKL 2553
            DKL
Sbjct: 841  DKL 843
  9629.m05250|protein  Elongation factor G, domain IV, putative
            Length = 826
            
 Score = 1530 bits (3918), Expect = 0.0
 Identities = 746/819 (91%), Positives = 791/819 (96%), Gaps = 2/819 (0%)
 Frame = +1

Query: 25   MVKFTAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 204
            MVKFT EE+R IMDKK+NIRNMSV+AHVDHGKSTLTDSLVAAAGIIAQ+VAGDVRMTD+R
Sbjct: 1    MVKFTVEEMRRIMDKKHNIRNMSVVAHVDHGKSTLTDSLVAAAGIIAQDVAGDVRMTDSR 60

Query: 205  ADEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALR 384
            +DEAERGITIKSTGISL+Y+M+ ESL+ YKGDRDG+EYLINLIDSPGHVDFSSEVTAALR
Sbjct: 61   SDEAERGITIKSTGISLYYEMSDESLKSYKGDRDGNEYLINLIDSPGHVDFSSEVTAALR 120

Query: 385  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR 564
            ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQV GEEAYQTFSR
Sbjct: 121  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVGGEEAYQTFSR 180

Query: 565  VIENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDEAKM 744
            VIENANVIMATYED LLGDVQVYPEKGTVAFSAGLHGWAFTL+NFAKMYASKFGVDE+KM
Sbjct: 181  VIENANVIMATYEDALLGDVQVYPEKGTVAFSAGLHGWAFTLSNFAKMYASKFGVDESKM 240

Query: 745  MERLWGENFFDPATKKWTSKNTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPMLKK 924
            MERLWGEN+FDP TKKWT K+TG+ TCKRGF+QFCYEPI+QII TCMNDQKDKL PML+K
Sbjct: 241  MERLWGENYFDPTTKKWTIKHTGSDTCKRGFIQFCYEPIRQIINTCMNDQKDKLLPMLQK 300

Query: 925  LGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGPLD 1104
            LGVTMK    DL GKALMKRVMQTWLPAS ALLEMMI+HLPSP+KAQRYRVENLYEGPLD
Sbjct: 301  LGVTMK----DLTGKALMKRVMQTWLPASNALLEMMIYHLPSPAKAQRYRVENLYEGPLD 356

Query: 1105 DIYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVPGQ 1284
            DIYA+AIRNCDP+GPLMLYVSKMIPASDKGRF+AFGRVF+GRVATGMKVRIMGPN+ PGQ
Sbjct: 357  DIYASAIRNCDPEGPLMLYVSKMIPASDKGRFYAFGRVFSGRVATGMKVRIMGPNYAPGQ 416

Query: 1285 KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEKEVDACPIRA 1464
            KKDLYVK+VQRTVIWMGKKQESVE VPCGNTVA+VGLDQFITKNATLTNEKEVDACPI+A
Sbjct: 417  KKDLYVKNVQRTVIWMGKKQESVEGVPCGNTVAMVGLDQFITKNATLTNEKEVDACPIKA 476

Query: 1465 MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI 1644
            MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCT+EESGEHIIAGAGELHLEI
Sbjct: 477  MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTVEESGEHIIAGAGELHLEI 536

Query: 1645 CLKDLQDDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 1824
            CLKDLQ+DFMGGAEI VSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARP+EEGL E
Sbjct: 537  CLKDLQEDFMGGAEITVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPMEEGLPE 596

Query: 1825 AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 2004
            AID+GRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPN+VVDMCKGVQYLNEI
Sbjct: 597  AIDEGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNIVVDMCKGVQYLNEI 656

Query: 2005 KDSVVAGFQWASKEGALAEENM--RGICFEVCDVVLHTDAIHRGGGQVIPTARRVIYASQ 2178
            KDSVVAGFQWASKEGALAEENM  RGICFEVCDV+LH+DAIHRGGGQ+IPTARRVIYA+Q
Sbjct: 657  KDSVVAGFQWASKEGALAEENMRGRGICFEVCDVILHSDAIHRGGGQIIPTARRVIYAAQ 716

Query: 2179 LTAKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRQGTPLYNIKAYLPVIES 2358
            LTAKPRLLEPVYLVEIQAPENALGGIY VLNQKRGHVFEEMQR GTPLYNIKAYLPVIES
Sbjct: 717  LTAKPRLLEPVYLVEIQAPENALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIES 776

Query: 2359 FGFSSTLRAATSGQAFPQCVFDHWDIMASDPLDPGTQSATL 2481
            FGF+STLRAATSGQAFP  VFDHW++++ DPL+PGT+  TL
Sbjct: 777  FGFTSTLRAATSGQAFPLFVFDHWEMLSVDPLEPGTRQLTL 817
  9629.m05092|protein  Elongation factor G, domain IV, putative
            Length = 853
            
 Score = 1375 bits (3520), Expect = 0.0
 Identities = 662/843 (78%), Positives = 752/843 (88%), Gaps = 10/843 (1%)
 Frame = +1

Query: 25   MVKFTAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 204
            MV+FTAEELR  MDKK+NIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQ+VAGDVRMTDTR
Sbjct: 1    MVRFTAEELRASMDKKDNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQDVAGDVRMTDTR 60

Query: 205  ADEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALR 384
            ADEAERGITIKSTGISL+Y+MT  +L  ++G RDG+ YLINLIDSPGH+DFSSEVTAALR
Sbjct: 61   ADEAERGITIKSTGISLYYEMTDAALRSFEGKRDGNSYLINLIDSPGHIDFSSEVTAALR 120

Query: 385  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR 564
            ITDGALVVVDCIEGVCVQTETVLRQ+L ERI+PVLTVNKMDRCFLELQ  GEEAYQ FSR
Sbjct: 121  ITDGALVVVDCIEGVCVQTETVLRQSLAERIKPVLTVNKMDRCFLELQQSGEEAYQAFSR 180

Query: 565  VIENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDEAKM 744
            VIE+ NV MA YED  LGD  V PEKGTVAFSAGLHGWAFTL+NFAKMY +KF VDEAKM
Sbjct: 181  VIESVNVTMAPYEDKNLGDCMVAPEKGTVAFSAGLHGWAFTLSNFAKMYKAKFKVDEAKM 240

Query: 745  MERLWGENFFDPATKKWTSK--NTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPML 918
            MERLWGEN+FD  TKKWT+   +T + TC+RGFVQFCYEPI++II+ CMND K+ LW ML
Sbjct: 241  MERLWGENYFDHTTKKWTTTAPSTSSKTCQRGFVQFCYEPIRRIISACMNDDKENLWDML 300

Query: 919  KKLGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGP 1098
             KL +T+K +EK+L GK LMKRVMQ WLPAS ALLEM++FHLPSP+KAQ+YRV+ LY+GP
Sbjct: 301  TKLKITLKAEEKELTGKKLMKRVMQAWLPASDALLEMIVFHLPSPAKAQQYRVDTLYDGP 360

Query: 1099 LDDIYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVP 1278
            LDD YA AIRNCDP GPLM+YVSKMIPASDKGRFFAFGRVF+G VATG KVRIMGPNFVP
Sbjct: 361  LDDPYATAIRNCDPKGPLMVYVSKMIPASDKGRFFAFGRVFSGTVATGNKVRIMGPNFVP 420

Query: 1279 GQKKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEKEVDACPI 1458
            G+KKDLYVK+VQRTVIWMGKKQESV+DVPCGNTVA+VGLDQFITKNATLT+EK VDA PI
Sbjct: 421  GEKKDLYVKTVQRTVIWMGKKQESVDDVPCGNTVAMVGLDQFITKNATLTDEKAVDAHPI 480

Query: 1459 RAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHL 1638
            +AMKFSVSPVVR +V CK AS+LPKLVEGLKRLAKSDP+V+CTIEESGEH+IAG G+LHL
Sbjct: 481  KAMKFSVSPVVRKSVACKNASELPKLVEGLKRLAKSDPLVVCTIEESGEHVIAGVGQLHL 540

Query: 1639 EICLKDLQDDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPL---- 1806
            EIC+KDLQ+DFMGGAEIIV PP++++RETV + SCRTVMSKSPNKHNRLYMEARPL    
Sbjct: 541  EICIKDLQEDFMGGAEIIVGPPIITYRETVTKNSCRTVMSKSPNKHNRLYMEARPLDKED 600

Query: 1807 ----EEGLAEAIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDM 1974
                E  L +AIDD RIGP+DD K R KILSEEFGWDKDLAKKIW FGPET GPN++VDM
Sbjct: 601  LQQDEPSLCKAIDDERIGPKDDIKERGKILSEEFGWDKDLAKKIWAFGPETKGPNLLVDM 660

Query: 1975 CKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHTDAIHRGGGQVIPTA 2154
            CKGVQYL+EIKDSVVAGFQWASKEGALAEENMRG+CFE+CDV LH+D+IHRGGGQ+IPTA
Sbjct: 661  CKGVQYLSEIKDSVVAGFQWASKEGALAEENMRGVCFELCDVTLHSDSIHRGGGQLIPTA 720

Query: 2155 RRVIYASQLTAKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRQGTPLYNIK 2334
            RR +YA+QLTA PRL+EP+Y V+IQ P+ A+G +YGVLN + G + EE +R GTPL N++
Sbjct: 721  RRAMYAAQLTASPRLMEPMYQVDIQVPKTAVGNVYGVLNSRNGELVEESERTGTPLSNLR 780

Query: 2335 AYLPVIESFGFSSTLRAATSGQAFPQCVFDHWDIMASDPLDPGTQSATLVTEIRKRKGLK 2514
             YLPV +SF F+  LRA TSGQAFPQC+F HW  M SDP   G+++A ++T+IRKRKGLK
Sbjct: 781  FYLPVAKSFDFTEKLRAETSGQAFPQCIFHHWQTMRSDPFQEGSEAAKVITDIRKRKGLK 840

Query: 2515 EQMTPLSDFEDKL 2553
            + +TPLSD+EDKL
Sbjct: 841  DIITPLSDYEDKL 853
  9634.m03897|protein  Elongation factor G, domain IV, putative
            Length = 997
            
 Score =  615 bits (1570), Expect = e-176
 Identities = 327/839 (38%), Positives = 507/839 (59%), Gaps = 22/839 (2%)
 Frame = +1

Query: 37   TAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIA---QEVAGDVRMTDTRA 207
            T + L G+      +RN++++ H+ HGK+   D LV     +     E    VR TDTR 
Sbjct: 134  TTDFLLGLAANPALVRNVALVGHLQHGKTVFMDMLVEQTHEVDTFDSEGERHVRFTDTRV 193

Query: 208  DEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALRI 387
            DE ER ++IK+  +SL  +             +G  YL N++D+PGHV+FS E+TAALRI
Sbjct: 194  DEQERRVSIKAVPMSLVLE-----------GGNGKSYLCNIMDTPGHVNFSDEMTAALRI 242

Query: 388  TDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSRV 567
             DGA++VVD  EGV V TE  +R A  ER+  V+ +NK+DR   EL++   +AY      
Sbjct: 243  ADGAVLVVDAAEGVMVNTERAIRHATQERLPIVVVINKVDRLITELKLPPNDAYFKLRHT 302

Query: 568  IENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGV--DEAK 741
            +E  N ++++    + G   V P  G V F++G  GW+FTL +FA +Y    G+  D  K
Sbjct: 303  LEAINDLISSCSTTVGGTQLVDPAAGNVCFASGSAGWSFTLQSFAHLYLKIHGIQFDHEK 362

Query: 742  MMERLWGENFFDPATKKWTSKNTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPMLK 921
               RLWG+ ++ P T+ +  K        R FV+F  EP+ +I +  + + K K+   L 
Sbjct: 363  FASRLWGDLYYHPDTRTFKKKPPKEGA-NRSFVEFVLEPLYKIYSQVVGESKGKVEATLS 421

Query: 922  KLGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGPL 1101
            +LGVT+ N    L  + L++   ++    S    +M++ H+PS   A   ++E++Y GP 
Sbjct: 422  ELGVTLSNAAYKLNVRPLLRLACRSIFGTSTGFTDMLVKHIPSVKDAAPRKIEHIYTGPQ 481

Query: 1102 DDIYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVPG 1281
            D    +A++ CDP  PLM+ V+K+ P SD   F AFGRV++G + TG  VR++G  + P 
Sbjct: 482  DSTIVDAMKKCDPHAPLMVNVTKLYPKSDCSVFDAFGRVYSGTIQTGQTVRVLGEGYSPD 541

Query: 1282 QKKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEK-EVDACPI 1458
             ++D+ VK V +  ++  + +  +   P G+ V + G+D  I K AT+   K + D    
Sbjct: 542  DEEDMTVKEVTKLWVYQARYRVPISKAPAGSWVLIEGVDASIMKTATICPMKMDEDVYIF 601

Query: 1459 RAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHL 1638
            R ++F+  PVV++A +    S+LPK+VEGL++++KS P+ +  +EESGEH I G GEL+L
Sbjct: 602  RPLRFNTLPVVKIAAEPLNPSELPKMVEGLRKISKSYPLAVTKVEESGEHTILGTGELYL 661

Query: 1639 EICLKDLQDDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGL 1818
            +  +KDL++ +    E+ V+ PVV+F ETV++ S     +++PNK N++ M A PLE+GL
Sbjct: 662  DSIMKDLRELY-SEVEVKVADPVVTFCETVVDTSSMKCFAETPNKRNKITMVAEPLEKGL 720

Query: 1819 AEAIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQY-- 1992
            AE I++G +      K  +    + + WD   A+ IW FGPE  GPN+++D    V+   
Sbjct: 721  AEDIENGLVSLDSRQKEITDFFRQRYQWDVLAARSIWAFGPEKQGPNILLDDTLSVEVDK 780

Query: 1993 --LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHTDAIHRGGGQVIPTARRVI 2166
              LN +KDS+V GFQW ++EG L +E +R + F++ +  +  + +HRGGGQ+IPTARRV+
Sbjct: 781  NLLNAVKDSIVQGFQWGAREGPLCDEPIRNVKFKILNANIAPEPLHRGGGQIIPTARRVV 840

Query: 2167 YASQLTAKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRQGTPLYNIKAYLP 2346
            Y++ L A PRL+EPVY +EIQ P + +  IY VL+++RGHV  ++ + GTP+Y +KA+LP
Sbjct: 841  YSAFLMANPRLMEPVYYIEIQTPIDCVSAIYTVLSRRRGHVTADVPKPGTPIYVVKAFLP 900

Query: 2347 VIESFGFSSTLRAATSGQAFPQCVFDHWDIMASDPLDPGTQSATL------------VTE 2490
            VIESFGF + LR  T GQAF   VFDHW I+  DPLD       L            + +
Sbjct: 901  VIESFGFETDLRYHTQGQAFCLSVFDHWAIVPGDPLDKNIVLRPLEPAPIQHLAREFMVK 960

Query: 2491 IRKRKGLKEQMTPLSDFEDKL 2553
             R+RKG+ E ++    F++ +
Sbjct: 961  TRRRKGMSEDVSINKFFDEAM 981
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 177243275 Number of Sequences: 59712 Number of extensions: 4902729 Number of successful extensions: 15690 Number of sequences better than 1.0e-10: 26 Number of HSP's better than 0.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 15638 Number of HSP's gapped (non-prelim): 29 length of query: 957 length of database: 26,991,925 effective HSP length: 54 effective length of query: 902 effective length of database: 23,767,477 effective search space: 21438264254 effective search space used: 21438264254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 163 (67.9 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG694   Members:47             3pri:Y   1e-166      
AAD26156.1       granule-bound starch synthase precursor [Triticum
aestivum]
         (2309 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9634.m00333|protein  granule-bound glycogen [starch] synth...  1025  0.0
 9635.m02174|protein  hypothetical protein                       763  0.0
 9634.m01225|protein  soluble starch synthase II-3, putative     329  1e-89
 9630.m05011|protein  soluble starch synthase II-2               320  5e-87
 9634.m00585|protein  glycosyl transferase, group 1 family ...   317  6e-86
 9638.m02586|protein  Similar to soluble starch synthase II-1    307  5e-83
 9629.m05069|protein  glycosyl transferase, group 1 family ...   202  2e-51
 9629.m05068|protein  glycosyl transferase, group 1 family ...   201  4e-51
 9633.m04286|protein  glycosyl transferase, group 1 family ...   190  8e-48
 9629.m05070|protein  glycosyl transferase, group 1 family ...   187  5e-47
 9632.m05172|protein  starch synthase III, putative              168  3e-41
 9633.m04287|protein  glycosyl transferase, group 1 family ...   164  6e-40
 9636.m00878|protein  Microtubule associated protein 1A/1B,...   137  9e-32
 9629.m05120|protein  retrotransposon protein, putative, Ty...    69  4e-11

  9634.m00333|protein  granule-bound glycogen [starch] synthase,
            chloroplast precursor(ec 2.4.1.11)
            Length = 617
            
 Score = 1025 bits (2622), Expect = 0.0
 Identities = 503/603 (83%), Positives = 544/603 (89%), Gaps = 15/603 (2%)
 Frame = +1

Query: 226  MAALATSQLATSGTVLGVTDR-----FRRPGFQGLRPRNPA--DAALGMRTIGASAAPKQ 384
            M+AL TSQLATS T  G+ DR       R GFQGL+PR+PA  DA     T  A A PKQ
Sbjct: 1    MSALTTSQLATSATGFGIADRSAPSSLLRHGFQGLKPRSPAGGDATSLSVTTSARATPKQ 60

Query: 385  SRKAHRGSRRCLSVVVRATGSGMNLVFVGAEMAPWSKTGGLGDVLGGLPPAMAANGHRVM 564
             R   RGSRR  SVVV ATG+GMN+VFVGAEMAPWSKTGGLGDVLGGLPPAMAANGHRVM
Sbjct: 61   QRSVQRGSRRFPSVVVYATGAGMNVVFVGAEMAPWSKTGGLGDVLGGLPPAMAANGHRVM 120

Query: 565  VVSPRYDQYKDAWDTSVISEIKVADEYERVRFFHCYKRGVDRVFIDHPWFLEKVRGKTKE 744
            V+SPRYDQYKDAWDTSV++EIKVAD YERVRFFHCYKRGVDRVFIDHP FLEKV GKT E
Sbjct: 121  VISPRYDQYKDAWDTSVVAEIKVADRYERVRFFHCYKRGVDRVFIDHPSFLEKVWGKTGE 180

Query: 745  KIYGPDAGTDYEDNQQRFSLLCQAALEAPRILNLNNNPYFSGPYGEDVVFVCNDWHTGLL 924
            KIYGPD G DY+DNQ RFSLLCQAALEAPRILNLNNNPYF G YGEDVVFVCNDWHTG L
Sbjct: 181  KIYGPDTGVDYKDNQMRFSLLCQAALEAPRILNLNNNPYFKGTYGEDVVFVCNDWHTGPL 240

Query: 925  ACYLKSNYQSNGIYRTAKVAFCIHNISYQGRFSFDDFAQLNLPDRFKSSFDFIDGYDKPV 1104
            A YLK+NYQ NGIYR AKVAFCIHNISYQGRF+F+D+ +LNL +RF+SSFDFIDGYD PV
Sbjct: 241  ASYLKNNYQPNGIYRNAKVAFCIHNISYQGRFAFEDYPELNLSERFRSSFDFIDGYDTPV 300

Query: 1105 EGRKINWMKAGILQADKVLTVSPYYAEELISGEARGCELDNIMRLTGITGIVNGMDVSEW 1284
            EGRKINWMKAGIL+AD+VLTVSPYYAEELISG ARGCELDNIMRLTGITGIVNGMDVSEW
Sbjct: 301  EGRKINWMKAGILEADRVLTVSPYYAEELISGIARGCELDNIMRLTGITGIVNGMDVSEW 360

Query: 1285 DPTKDKFLAVNYDITT--------ALEAKALNKEALQAEVGLPVDRKVPLVAFIGRLEEQ 1440
            DP+KDK++   YD TT        A+EAKALNKEALQAE GLPVDRK+PL+AFIGRLEEQ
Sbjct: 361  DPSKDKYITAKYDATTARMSDKFQAIEAKALNKEALQAEAGLPVDRKIPLIAFIGRLEEQ 420

Query: 1441 KGPDVMIAAIPEILKEEDVQIILLGTGKKKFEKLLKSMEEKFPGKVRAVVRFNAPLAHQM 1620
            KGPDVM AAIPE++ +EDVQI+LLGTGKKKFEKLLKSMEEK+PGKVRAVV+FNAPLAH +
Sbjct: 421  KGPDVMAAAIPELM-QEDVQIVLLGTGKKKFEKLLKSMEEKYPGKVRAVVKFNAPLAHLI 479

Query: 1621 MAGADLLAVTSRFEPCGLIQLQGMRYGTPCVCASTGGLVDTIVEGKTGFHMGRLSVDCNV 1800
            MAGAD+LAV SRFEPCGLIQLQGMRYGTPC CASTGGLVDT++EGKTGFHMGRLSVDC V
Sbjct: 480  MAGADVLAVPSRFEPCGLIQLQGMRYGTPCACASTGGLVDTVIEGKTGFHMGRLSVDCKV 539

Query: 1801 VEPADVKKVATTLKRAVKVVGTPAYQEMVKNCMIQDLSWKGPAKNWEDVLLELGVEGSEP 1980
            VEP+DVKKVA TLKRA+KVVGTPAY+EMV+NCM QDLSWKGPAKNWE+VLL LGV GS P
Sbjct: 540  VEPSDVKKVAATLKRAIKVVGTPAYEEMVRNCMNQDLSWKGPAKNWENVLLGLGVAGSAP 599

Query: 1981 GIVGEEIAPLAMENVAAP 2034
            GI G+EIAPLA ENVAAP
Sbjct: 600  GIEGDEIAPLAKENVAAP 617
  9635.m02174|protein  hypothetical protein
            Length = 610
            
 Score =  763 bits (1948), Expect = 0.0
 Identities = 362/530 (68%), Positives = 425/530 (79%), Gaps = 7/530 (1%)
 Frame = +1

Query: 445  SGMNLVFVGAEMAPWSKTGGLGDVLGGLPPAMAAN------GHRVMVVSPRYDQYKDAWD 606
            +GM ++F+  E  PW KTGGLGDVLGGLPPA+A N      GHRVM + PRYDQYKDAWD
Sbjct: 75   AGMTIIFIATECHPWCKTGGLGDVLGGLPPALAVNILCHAMGHRVMTIVPRYDQYKDAWD 134

Query: 607  TSVISEIKVADEYERVRFFHCYKRGVDRVFIDHPWFLEKVRGKTKEKIYGPDAGTDYEDN 786
            T+V+ E+ + D  E VRFFHCYKRGVDRVF+DHP FLEKV GKT  K+YGP  G DY DN
Sbjct: 135  TNVLVEVNIGDRTETVRFFHCYKRGVDRVFVDHPMFLEKVWGKTGPKLYGPTTGDDYRDN 194

Query: 787  QQRFSLLCQAALEAPRILNLNNNPYFSGPYGEDVVFVCNDWHTGLLACYLKSNYQSNGIY 966
            Q RF LLC AALEAPR+LNLNN+ YFSGPYGE+VVFV NDWHTG+L CYLKS YQ+ G+Y
Sbjct: 195  QLRFCLLCLAALEAPRVLNLNNSEYFSGPYGENVVFVANDWHTGVLPCYLKSIYQAKGMY 254

Query: 967  RTAKVAFCIHNISYQGRFSFDDFAQLNLPDRFKSSFDFIDGYDKPVEGRKINWMKAGILQ 1146
              AKVAFCIHNI+YQGRF+ +DF  LNLPD F  SFDFIDG+ KPV GRKINWMKAGI +
Sbjct: 255  VNAKVAFCIHNIAYQGRFAREDFELLNLPDSFLPSFDFIDGHFKPVVGRKINWMKAGITE 314

Query: 1147 ADKVLTVSPYYAEELISGEARGCELDNIMRLTGI-TGIVNGMDVSEWDPTKDKFLAVNYD 1323
             D V+TVSP+Y +EL SG  +G ELD I+R   + TGIVNGMDV EW+P  D++++V YD
Sbjct: 315  CDLVMTVSPHYVKELASGPDKGVELDGILRTKPLETGIVNGMDVYEWNPATDQYISVKYD 374

Query: 1324 ITTALEAKALNKEALQAEVGLPVDRKVPLVAFIGRLEEQKGPDVMIAAIPEILKEEDVQI 1503
             TT  EA+ALNKE LQAEVGLPVD  +PL+ F+GRLEEQKG D++IAAIPE + E +VQI
Sbjct: 375  ATTVTEARALNKEMLQAEVGLPVDSSIPLIVFVGRLEEQKGSDILIAAIPEFV-EGNVQI 433

Query: 1504 ILLGTGKKKFEKLLKSMEEKFPGKVRAVVRFNAPLAHQMMAGADLLAVTSRFEPCGLIQL 1683
            I+LGTGKKK E+ L  +E K+P   R + +FN PLAH M AGAD + V SRFEPCGLIQL
Sbjct: 434  IVLGTGKKKMEEELILLEVKYPNNARGIAKFNVPLAHMMFAGADFIIVPSRFEPCGLIQL 493

Query: 1684 QGMRYGTPCVCASTGGLVDTIVEGKTGFHMGRLSVDCNVVEPADVKKVATTLKRAVKVVG 1863
            QGMRYG   +C+STGGLVDT+ EG TGFHMG  +V+C  V+P DV  VA+T+KRA+K   
Sbjct: 494  QGMRYGVVPICSSTGGLVDTVKEGVTGFHMGLFNVECETVDPVDVTAVASTVKRALKQYN 553

Query: 1864 TPAYQEMVKNCMIQDLSWKGPAKNWEDVLLELGVEGSEPGIVGEEIAPLAMENVAAP 2034
            TPA+QEMV+NCM QDLSWKGPAK WE+VLL LGVEGS+PGI GEE+APLA ENVA P
Sbjct: 554  TPAFQEMVQNCMAQDLSWKGPAKKWEEVLLGLGVEGSQPGIEGEELAPLAKENVATP 610
  9634.m01225|protein  soluble starch synthase II-3, putative
            Length = 810
            
 Score =  329 bits (834), Expect = 1e-89
 Identities = 205/502 (40%), Positives = 286/502 (56%), Gaps = 8/502 (1%)
 Frame = +1

Query: 451  MNLVFVGAEMAPWSKTGGLGDVLGGLPPAMAANGHRVMVVSPRYDQYKDAWDTSVISEIK 630
            MN++ V AE +PW KTGGLGDV G LP A+A  GHRVMVV PRY  Y +A D  +    K
Sbjct: 319  MNVIVVAAECSPWCKTGGLGDVAGALPKALARRGHRVMVVVPRYGDYAEAQDVGIRKYYK 378

Query: 631  VADEYERVRFFHCYKRGVDRVFIDHPWFLEKVRGKTKEKIYGPDAGTDYEDNQQRFSLLC 810
             A +   V++FH +  GVD VFID P F  +     ++ IYG +     ++  +R  L C
Sbjct: 379  AAGQDLEVKYFHAFIDGVDFVFIDAPLFRHR-----QDDIYGGNR----QEIMKRMILFC 429

Query: 811  QAALEAPRILNLNNNPYFSGPYGEDVVFVCNDWHTGLLACYLKSNYQSNGIYRTAKVAFC 990
            +AA+E P  +     PY  G    ++VF+ NDWHT LL  YLK+ Y+ NG+ +  +    
Sbjct: 430  KAAVEVPWHVPCGGVPYGDG----NLVFLANDWHTALLPVYLKAYYRDNGMMQYTRSVLV 485

Query: 991  IHNISYQGRFSFDDFAQLNLPDRFKSSFDFIDGYDKPVEGRKINWMKAGILQADKVLTVS 1170
            IHNI+YQGR   D+F  + LP+ +   F   D    PV G   N   AG+  AD+V+TVS
Sbjct: 486  IHNIAYQGRGPVDEFPYMELPEHYLDHFKLYD----PVGGEHANIFGAGLKMADRVVTVS 541

Query: 1171 PYYAEELISGEARGCELDNIMRLTG--ITGIVNGMDVSEWDPTKDKFLA----VNYDITT 1332
            P Y  EL + E  G  L +I+R     + GIVNG+D  EW+P  D  L      NY + +
Sbjct: 542  PGYLWELKTTEG-GWGLHDIIRENDWKMNGIVNGIDYREWNPEVDVHLQSDGYANYTVAS 600

Query: 1333 ALEAKALNKEALQAEVGLPVDRKVPLVAFIGRLEEQKGPDVMIAAIPEILKEEDVQIILL 1512
               +K   K ALQ E+GL V   VPL+ FIGRL+ QKG D++  A+P I   +DVQ++LL
Sbjct: 601  LDSSKPRCKAALQRELGLEVRDDVPLIGFIGRLDGQKGVDIIGDAMPWI-AGQDVQLVLL 659

Query: 1513 GTGKKKFEKLLKSMEEKFPGKVRAVVRFNAPLAHQMMAGADLLAVTSRFEPCGLIQLQGM 1692
            G+G++  E +L+  E +   KVR  V F+  +AH++ AGAD+L + SRFEPCGL QL  M
Sbjct: 660  GSGRRDLEVMLQRFEAQHNSKVRGWVGFSVKMAHRITAGADVLVMPSRFEPCGLNQLYAM 719

Query: 1693 RYGTPCVCASTGGLVDTIVEGKTGFHMGRLSVDCNVVEPADVKKVATTLKRAVKVVG--T 1866
             YGT  V  + GGL DT +     F    L    +  EP    K+   L   ++      
Sbjct: 720  AYGTVPVVHAVGGLRDT-MSAFDPFEDTGLGWTFDRAEP---HKLIEALGHCLETYRKYK 775

Query: 1867 PAYQEMVKNCMIQDLSWKGPAKNWEDVLLE 1956
             +++ +    M QDLSW   A+ +E+VL++
Sbjct: 776  ESWRGLQVRGMSQDLSWDHAAELYEEVLVK 805
  9630.m05011|protein  soluble starch synthase II-2
            Length = 694
            
 Score =  320 bits (812), Expect = 5e-87
 Identities = 199/502 (39%), Positives = 283/502 (55%), Gaps = 12/502 (2%)
 Frame = +1

Query: 451  MNLVFVGAEMAPWSKTGGLGDVLGGLPPAMAANGHRVMVVSPRYDQYKDAWDTSVISEIK 630
            MN++ V +E +P+ KTGGLGDV+G LP A+A  GHRVMVV PRY +Y +A D  V    +
Sbjct: 203  MNVIVVASECSPFCKTGGLGDVVGALPKALARRGHRVMVVIPRYGEYAEAKDLGVRKRYR 262

Query: 631  VADEYERVRFFHCYKRGVDRVFIDHPWFLEKVRGKTKEKIYGPDAGTDYEDNQQRFSLLC 810
            VA +   V +FH +  GVD VF++ P F  +        IYG +      D  +R  L C
Sbjct: 263  VAGQDSEVSYFHAFIDGVDFVFLEAPPFRHR-----HNDIYGGER----FDVLKRMILFC 313

Query: 811  QAALEAPRILNLNNNPYFSGPYGEDVVFVCNDWHTGLLACYLKSNYQSNGIYRTAKVAFC 990
            +AA+E P       + Y  G    ++VF+ NDWHT LL  YLK+ Y+ NG+ +  +    
Sbjct: 314  KAAVEVPWFAPCGGSIYGDG----NLVFIANDWHTALLPVYLKAYYRDNGLMQYTRSVLV 369

Query: 991  IHNISYQGRFSFDDFAQLNLPDRFKSSFDFIDGYDKPVEGRKINWMKAGILQADKVLTVS 1170
            IHNI++QGR   DDFA ++LP+ +   F   D    PV G   N   AG+  AD+ +TVS
Sbjct: 370  IHNIAHQGRGPVDDFATMDLPEHYIDHFRLYD----PVGGEHSNVFAAGLKMADRAVTVS 425

Query: 1171 PYYAEELISGEARGCELDNIMRLTG--ITGIVNGMDVSEWDPTKDKFLA----VNYDITT 1332
              Y  E+ + +  G  L  I+      + GIVNG+D++EW+P  D+ L      NY   T
Sbjct: 426  HGYLWEIKTMDG-GWGLHEIINHNDWKLQGIVNGIDMAEWNPEVDEHLQSDGYANYTFET 484

Query: 1333 ALEAKALNKEALQAEVGLPVDRKVPLVAFIGRLEEQKGPDVMIAAIPEILKEEDVQIILL 1512
                K   KEALQ ++GL V   VPL+ FIGRL+ QKG D++  A+P I   +DVQ+++L
Sbjct: 485  LDTGKKQCKEALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIGDAMPWI-AGQDVQVVML 543

Query: 1513 GTGKKKFEKLLKSMEEKFPGKVRAVVRFNAPLAHQMMAGADLLAVTSRFEPCGLIQLQGM 1692
            GTG+   E++L+  E +   KVR  V F+  LAH++ AGAD+L + SRFEPCGL QL  M
Sbjct: 544  GTGRPDLEEMLRRFESEHNDKVRGWVGFSVQLAHRITAGADVLLMPSRFEPCGLNQLYAM 603

Query: 1693 RYGTPCVCASTGGLVDTIVE----GKTGFHMGRLSVDCNVVEPADVKKVATTLKRAVKVV 1860
             YGT  V  + GGL DT+        TG             + A+  ++   L   +   
Sbjct: 604  AYGTVPVVHAVGGLRDTVAPFDPFADTGLGW--------TFDRAEANRMIDALGHCLNTY 655

Query: 1861 GT--PAYQEMVKNCMIQDLSWKGPAKNWEDVLLE 1956
                 +++ +    M QDLSW   A+ +EDVL++
Sbjct: 656  RNYKESWRGLQARGMAQDLSWDHAAELYEDVLVK 689
  9634.m00585|protein  glycosyl transferase, group 1 family protein,
            putative
            Length = 641
            
 Score =  317 bits (803), Expect = 6e-86
 Identities = 188/498 (37%), Positives = 288/498 (57%), Gaps = 17/498 (3%)
 Frame = +1

Query: 454  NLVFVGAEMAPWSKTGGLGDVLGGLPPAMAANGHRVMVVSPRY------DQYKDAWDTSV 615
            ++VFV  E +P++K+GGLGDV G LP A+A  GHRVMVV PRY        + +A+ T  
Sbjct: 134  SVVFVTGEASPYAKSGGLGDVCGSLPIALALRGHRVMVVMPRYMNGALNKNFANAFYTEK 193

Query: 616  ISEIKVADEYERVRFFHCYKRGVDRVFIDHPWFLEKVRGKTKEKIYGPDAGTDYEDNQQR 795
              +I        V FFH Y+  VD VF+DHP +           +YG + G  + DNQ R
Sbjct: 194  HIKIPCFGGEHEVTFFHEYRDSVDWVFVDHPSY------HRPGNLYGDNFGA-FGDNQFR 246

Query: 796  FSLLCQAALEAPRILNLNNNPYFSGPYGEDVVFVCNDWHTGLLACYLKSNYQSNGIYRTA 975
            ++LLC AA EAP IL L    Y    YG+  +FV NDWH  L+   L + Y+  G+YR A
Sbjct: 247  YTLLCYAACEAPLILELGG--YI---YGQKCMFVVNDWHASLVPVLLAAKYRPYGVYRDA 301

Query: 976  KVAFCIHNISYQGRFSFDDFAQLNLPDRFKSSFDFI-------DGYDKPVEGRKINWMKA 1134
            +    IHN+++QG      +  L LP  +  + +++          DK   G  +N++K 
Sbjct: 302  RSVLVIHNLAHQGVEPASTYPDLGLPPEWYGALEWVFPEWARRHALDK---GEAVNFLKG 358

Query: 1135 GILQADKVLTVSPYYAEELISGEARGCELDNIM--RLTGITGIVNGMDVSEWDPTKDKFL 1308
             ++ AD+++TVS  Y+ E+ + E  G  L+ ++  R + + GIVNG+D+++W+P+ DKFL
Sbjct: 359  AVVTADRIVTVSQGYSWEVTTAEG-GQGLNELLSSRKSVLNGIVNGIDINDWNPSTDKFL 417

Query: 1309 AVNYDITTALEAKALNKEALQAEVGLPVDRKVPLVAFIGRLEEQKGPDVMIAAIPEILKE 1488
              +Y +   L  KA  K  LQ E+GLP+   VPL+ FIGRL+ QKG D++  AIP+++++
Sbjct: 418  PYHYSVDD-LSGKAKCKAELQKELGLPIRPDVPLIGFIGRLDYQKGIDLIKLAIPDLMRD 476

Query: 1489 EDVQIILLGTGKKKFEKLLKSMEEKFPGKVRAVVRFNAPLAHQMMAGADLLAVTSRFEPC 1668
             ++Q ++LG+G   FE  ++S E  +  K R  V F+ P++H++ AG D+L + SRFEPC
Sbjct: 477  -NIQFVMLGSGDPGFEGWMRSTESGYRDKFRGWVGFSVPVSHRITAGCDILLMPSRFEPC 535

Query: 1669 GLIQLQGMRYGTPCVCASTGGLVDTIVEGKTGFHMGRLSVDCNVVEPADVKKVATTLKRA 1848
            GL QL  M+YGT  V   TGGL DT+         G          P  ++K+   L+ A
Sbjct: 536  GLNQLYAMQYGTVPVVHGTGGLRDTVENFNPFAEKGEQGTGW-AFSPLTIEKMLWALRMA 594

Query: 1849 VKVV--GTPAYQEMVKNCMIQDLSWKGPAKNWEDV 1947
            +        +++ ++K  M  D +W   A  +E +
Sbjct: 595  ISTYREHKSSWEGLMKRGMSSDFTWDHAASQYEQI 629
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 171624854 Number of Sequences: 59712 Number of extensions: 6124345 Number of successful extensions: 97889 Number of sequences better than 1.0e-10: 28 Number of HSP's better than 0.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 97749 Number of HSP's gapped (non-prelim): 66 length of query: 769 length of database: 26,991,925 effective HSP length: 53 effective length of query: 716 effective length of database: 23,827,189 effective search space: 17060267324 effective search space used: 17060267324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 162 (67.5 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG698   Members:364            3pri:Y   5e-54       
T05950           lipid transfer protein 7a2b - barley emb|CAA65680.1|
lipid transfer protein 7a2b [Hordeum vulgare subsp. vulga
         (982 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9640.m00136|protein  lipid-transfer protein - maize             155  8e-38
 9639.m00148|protein  lipid-transfer protein - maize             155  1e-37
 9640.m00135|protein  lipid-transfer protein - maize             150  3e-36
 9639.m00146|protein  lipid-transfer protein - maize             148  2e-35
 9640.m00132|protein  lipid transfer protein                     133  4e-31
 9639.m00141|protein  lipid transfer protein                     133  4e-31
 9639.m02120|protein  phospholipid transfer protein homolog...   116  4e-26
 9639.m00143|protein  nonspecific lipid-transfer protein 2 ...   115  1e-25
 9640.m00133|protein  nonspecific lipid-transfer protein 2 ...   114  3e-25
 9639.m00145|protein  Protease inhibitor/seed storage/LTP f...   114  3e-25
 9640.m00131|protein  Similar to nonspecific lipid-transfer...   113  4e-25
 9640.m00134|protein  phospholipid transfer protein homolog...   111  1e-24
 9639.m00139|protein  Similar to nonspecific lipid-transfer...   111  2e-24
 9636.m00287|protein  nonspecific lipid-transfer protein a ...   101  2e-21
 9633.m03731|protein  Protease inhibitor/seed storage/LTP f...    90  5e-18
 9630.m02307|protein  Similar to nonspecific lipid-transfer...    83  7e-16
 9629.m01162|protein  Protease inhibitor/seed storage/LTP f...    83  9e-16
 9629.m05973|protein  Protease inhibitor/seed storage/LTP f...    82  2e-15
 9629.m05974|protein  Protease inhibitor/seed storage/LTP f...    82  2e-15
 9634.m03292|protein  Protease inhibitor/seed storage/LTP f...    82  2e-15

  9640.m00136|protein  lipid-transfer protein - maize
           Length = 118
           
 Score =  155 bits (389), Expect = 8e-38
 Identities = 77/121 (63%), Positives = 97/121 (79%)
 Frame = +3

Query: 48  MARLNSKAVAAAVVLAAVVLMMAGREASAALSCGQVDSKLAPCVAYVTGRASAISKECCS 227
           MA LN K V A +V+A VV   A   ASAA++CGQV S +APC++YVTGR S +++ CC+
Sbjct: 1   MAALNGKVVVAVMVVAMVV---AAPGASAAITCGQVGSAIAPCISYVTGR-SGLTQGCCN 56

Query: 228 GVQGLNGLARSSPDRQTACRCLKSLATSIKAINMGKVSGVPGKCGVSVPFPISMSTDCNK 407
           GV+GLN  AR++ DRQ ACRCLKSLA SIK++N+G V+GVPGKCGV+V FPIS+STDCNK
Sbjct: 57  GVKGLNNAARTTADRQAACRCLKSLAGSIKSLNLGTVAGVPGKCGVNVGFPISLSTDCNK 116

Query: 408 V 410
           V
Sbjct: 117 V 117
  9639.m00148|protein  lipid-transfer protein - maize
           Length = 118
           
 Score =  155 bits (387), Expect = 1e-37
 Identities = 76/121 (62%), Positives = 97/121 (79%)
 Frame = +3

Query: 48  MARLNSKAVAAAVVLAAVVLMMAGREASAALSCGQVDSKLAPCVAYVTGRASAISKECCS 227
           MA +N K V A +V+A VV   A   ASAA++CGQV S +APC++YVTGR S +++ CC+
Sbjct: 1   MAAVNCKVVVAVIVVAMVV---AAPGASAAITCGQVGSAIAPCISYVTGR-SGLTQGCCN 56

Query: 228 GVQGLNGLARSSPDRQTACRCLKSLATSIKAINMGKVSGVPGKCGVSVPFPISMSTDCNK 407
           GV+GLN  AR++ DRQ ACRCLKSLA SIK++N+G V+GVPGKCGV+V FPIS+STDCNK
Sbjct: 57  GVKGLNNAARTTADRQAACRCLKSLAGSIKSLNLGTVAGVPGKCGVNVGFPISLSTDCNK 116

Query: 408 V 410
           V
Sbjct: 117 V 117
  9640.m00135|protein  lipid-transfer protein - maize
           Length = 118
           
 Score =  150 bits (376), Expect = 3e-36
 Identities = 73/121 (60%), Positives = 97/121 (79%)
 Frame = +3

Query: 48  MARLNSKAVAAAVVLAAVVLMMAGREASAALSCGQVDSKLAPCVAYVTGRASAISKECCS 227
           MA LN KAVAA +V+A VV   A   ASAA++CGQV S +APC++YVTGR   +++ CC+
Sbjct: 1   MAALNFKAVAAVMVMAMVV---AAPGASAAITCGQVGSAIAPCISYVTGRGG-LTQGCCN 56

Query: 228 GVQGLNGLARSSPDRQTACRCLKSLATSIKAINMGKVSGVPGKCGVSVPFPISMSTDCNK 407
           GV+GLN  AR++ DRQ ACRCLK+LA +IK++N+G  +G+PGKCGV+V FPIS+STDC+K
Sbjct: 57  GVKGLNNAARTTADRQAACRCLKTLAGTIKSLNLGAAAGIPGKCGVNVGFPISLSTDCSK 116

Query: 408 V 410
           V
Sbjct: 117 V 117
  9639.m00146|protein  lipid-transfer protein - maize
           Length = 118
           
 Score =  148 bits (369), Expect = 2e-35
 Identities = 71/121 (58%), Positives = 95/121 (77%)
 Frame = +3

Query: 48  MARLNSKAVAAAVVLAAVVLMMAGREASAALSCGQVDSKLAPCVAYVTGRASAISKECCS 227
           MA LN K V A +V+A VV   A   ASAA++CGQV S +APC++YVTGR   +++ CC+
Sbjct: 1   MAALNGKVVVAVMVVAMVV---AAPGASAAITCGQVGSAIAPCISYVTGRGG-LTQGCCN 56

Query: 228 GVQGLNGLARSSPDRQTACRCLKSLATSIKAINMGKVSGVPGKCGVSVPFPISMSTDCNK 407
           GV+GLN  AR++ DRQ ACRCLK+LA +IK++N+G  +G+PGKCGV+V FPIS+STDC+K
Sbjct: 57  GVKGLNNAARTTADRQAACRCLKTLAGTIKSLNLGAAAGIPGKCGVNVGFPISLSTDCSK 116

Query: 408 V 410
           V
Sbjct: 117 V 117
  9640.m00132|protein  lipid transfer protein
           Length = 121
           
 Score =  133 bits (332), Expect = 4e-31
 Identities = 60/116 (51%), Positives = 82/116 (69%)
 Frame = +3

Query: 66  KAVAAAVVLAAVVLMMAGREASAALSCGQVDSKLAPCVAYVTGRASAISKECCSGVQGLN 245
           + +A   ++A V   +    ASAA+SCG V S +APC++YV GR S+ S  CCSGV+ LN
Sbjct: 6   RTMALVALVAVVAAAVVAERASAAVSCGDVTSSIAPCLSYVMGRESSPSSSCCSGVRTLN 65

Query: 246 GLARSSPDRQTACRCLKSLATSIKAINMGKVSGVPGKCGVSVPFPISMSTDCNKVH 413
           G A SS DR+TAC CLK++A+S + +NMG  + +P KCGVSV FPIS S DC+K++
Sbjct: 66  GKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVAFPISTSVDCSKIN 121
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63023512 Number of Sequences: 59712 Number of extensions: 1893344 Number of successful extensions: 36271 Number of sequences better than 1.0e-10: 42 Number of HSP's better than 0.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 36237 Number of HSP's gapped (non-prelim): 22 length of query: 327 length of database: 26,991,925 effective HSP length: 51 effective length of query: 275 effective length of database: 23,946,613 effective search space: 6585318575 effective search space used: 6585318575 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG820   Members:372            3pri:Y   1e-100      
S21386           chlorophyll a/b-binding protein CP29 precursor -
barley emb|CAA44777.1| Precursor of CP29, core chlorophyll a/
         (1437 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9639.m01284|protein  chlorophyll a/b-binding protein CP26 ...   524  e-148
 9639.m01283|protein  chlorophyll a/b-binding protein CP26 ...   365  e-100
 9637.m01516|protein  chlorophyll a/b-binding protein I pre...   223  7e-58
 9629.m05067|protein  Chlorophyll A-B binding protein, puta...   223  7e-58
 9629.m03990|protein  Chlorophyll A-B binding protein, puta...   221  3e-57
 9631.m03807|protein  chlorophyll a/b binding protein            214  3e-55
 9635.m03724|protein  chlorophyll a-b binding protein of lh...   208  3e-53
 9637.m00977|protein  Chlorophyll A-B binding protein, puta...   182  1e-45
 9634.m02114|protein  chlorophyll a/b-binding protein precu...   142  2e-33
 9630.m05194|protein  light-harvesting complex protein [imp...   141  2e-33
 9635.m03882|protein  LHCI-680, photosystem I antenna prote...   137  5e-32
 9635.m03689|protein  probable chlorophyll a/b-binding prot...   132  1e-30
 9637.m02343|protein  AY086461 PSI type II chlorophyll a/b-...   127  5e-29
 9636.m03389|protein  chlorophyll a/b-binding protein presu...   126  8e-29
 9630.m00958|protein  chlorophyll a/b-binding protein type ...   123  7e-28
 9630.m00957|protein  chlorophyll a/b-binding protein type ...    81  4e-17
 9633.m03752|protein  retrotransposon protein, putative, un...    71  6e-12
 9629.m00408|protein  expressed protein                           71  6e-12
 9629.m05120|protein  retrotransposon protein, putative, Ty...    70  8e-12

  9639.m01284|protein  chlorophyll a/b-binding protein CP26 precursor
           - maize
           Length = 283
           
 Score =  524 bits (1334), Expect = e-148
 Identities = 255/286 (89%), Positives = 267/286 (93%)
 Frame = +2

Query: 134 MAALAPTKMLGTRLDFAGSSRYATAAPTAGAQKIVSLFDRFNKKPAPKPKPAPVATSSAG 313
           MAALAP+KMLGTRL+FAGSSRYATAAPT GAQKIVSLF   +KKPAPKPKPA V +SS  
Sbjct: 1   MAALAPSKMLGTRLNFAGSSRYATAAPTTGAQKIVSLF---SKKPAPKPKPAAVTSSSPD 57

Query: 314 IDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKPEDFAKYQAFE 493
           I DELAKWYGPDRRI+LP GLLDRSEVP+YLNGEVPGDYGYDPFGL KKPEDF+KYQA+E
Sbjct: 58  IGDELAKWYGPDRRIFLPEGLLDRSEVPDYLNGEVPGDYGYDPFGLSKKPEDFSKYQAYE 117

Query: 494 LIHARWAMLGAAGFIIPEALNKFGANCGPEAVWFKTGALLLDGNTLNYFGNSIPINLILA 673
           LIHARWAMLGAAGFIIPEA NKFGANCGPEAVWFKTGALLLDGNTLNYFGNSIPINLI+A
Sbjct: 118 LIHARWAMLGAAGFIIPEACNKFGANCGPEAVWFKTGALLLDGNTLNYFGNSIPINLIVA 177

Query: 674 VVAEVVLVGGAEYYRITNGLEFDDKLHPGGPFDPLGLATDPDQAALLKVKEIKNGRLAMF 853
           V AEVVLVGGAEYYRI NGL+ +DKLHPGGPFDPLGLA+DPDQAALLKVKEIKNGRLAMF
Sbjct: 178 VAAEVVLVGGAEYYRIINGLDLEDKLHPGGPFDPLGLASDPDQAALLKVKEIKNGRLAMF 237

Query: 854 SMLGFFIQAYVTGEGPFENLCAHLSDPFGNNLLTVISGAAERVPSL 991
           SMLGFFIQAYVTGEGP ENL  HLSDPFGNNLLTVISGAAER PSL
Sbjct: 238 SMLGFFIQAYVTGEGPVENLSKHLSDPFGNNLLTVISGAAERTPSL 283
  9639.m01283|protein  chlorophyll a/b-binding protein CP26 precursor
           - maize
           Length = 245
           
 Score =  365 bits (926), Expect = e-100
 Identities = 177/200 (88%), Positives = 186/200 (92%)
 Frame = +2

Query: 134 MAALAPTKMLGTRLDFAGSSRYATAAPTAGAQKIVSLFDRFNKKPAPKPKPAPVATSSAG 313
           MAALAP+KMLGTRL+FAGSSRYATAAPT GAQKIVSLF   +KKPAPKPKPA V +SS  
Sbjct: 1   MAALAPSKMLGTRLNFAGSSRYATAAPTTGAQKIVSLF---SKKPAPKPKPAAVTSSSPD 57

Query: 314 IDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKPEDFAKYQAFE 493
           I DELAKWYGPDRRI+LP GLLDRSEVP+YLNGEVPGDYGYDPFGL KKPEDF+KYQA+E
Sbjct: 58  IGDELAKWYGPDRRIFLPEGLLDRSEVPDYLNGEVPGDYGYDPFGLSKKPEDFSKYQAYE 117

Query: 494 LIHARWAMLGAAGFIIPEALNKFGANCGPEAVWFKTGALLLDGNTLNYFGNSIPINLILA 673
           LIHARWAMLGAAGFIIPEA NKFGANCGPEAVWFKTGALLLDGNTLNYFGNSIPINLI+A
Sbjct: 118 LIHARWAMLGAAGFIIPEACNKFGANCGPEAVWFKTGALLLDGNTLNYFGNSIPINLIVA 177

Query: 674 VVAEVVLVGGAEYYRITNGL 733
           V AEVVLVGGAEYYRI NGL
Sbjct: 178 VAAEVVLVGGAEYYRIINGL 197
  9637.m01516|protein  chlorophyll a/b-binding protein I precursor -
           rice
           Length = 265
           
 Score =  223 bits (562), Expect = 7e-58
 Identities = 129/229 (56%), Positives = 152/229 (66%), Gaps = 5/229 (2%)
 Frame = +2

Query: 260 KKPAPKPKPAPVATSSAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 439
           +K A KPKPA    +S+G     + WYG DR +YL  G L   E P YL GE PGDYG+D
Sbjct: 33  RKTAAKPKPA----ASSG-----SPWYGADRVLYL--GPLS-GEPPSYLTGEFPGDYGWD 80

Query: 440 PFGLGKKPEDFAKYQAFELIHARWAMLGAAGFIIPEALNKFGANCGPEAVWFKTGALLLD 619
             GL   PE FAK +  E+IH+RWAMLGA G + PE L + G   G EAVWFK G+ +  
Sbjct: 81  TAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGSQIFS 139

Query: 620 GNTLNYFGNSIPINL--ILAVVA-EVVLVGGAEYYRITNGL--EFDDKLHPGGPFDPLGL 784
              L+Y GN   I+   ILA+ A +VVL+G  E YRI  G   E  D L+PGG FDPLGL
Sbjct: 140 EGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGAFDPLGL 199

Query: 785 ATDPDQAALLKVKEIKNGRLAMFSMLGFFIQAYVTGEGPFENLCAHLSDPFGNN 946
           A DP+  A LKVKEIKNGRLAMFSM GFF+QA VTG+GP ENL  HL+DP  NN
Sbjct: 200 ADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 253
  9629.m05067|protein  Chlorophyll A-B binding protein, putative
           Length = 265
           
 Score =  223 bits (562), Expect = 7e-58
 Identities = 134/253 (52%), Positives = 159/253 (61%), Gaps = 11/253 (4%)
 Frame = +2

Query: 188 SSRYATAAPTAGAQKIVSLFDRFN------KKPAPKPKPAPVATSSAGIDDELAKWYGPD 349
           +S  A ++P A A K V+    F       +K A KPKPA  + S          WYG D
Sbjct: 3   ASTMALSSPAALAGKAVANAKVFGEGRVTMRKSAAKPKPAAASGSP---------WYGAD 53

Query: 350 RRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKPEDFAKYQAFELIHARWAMLGAA 529
           R +YL  G L   E P YL GE PGDYG+D  GL   PE FAK +  E+IH RWAMLGA 
Sbjct: 54  RVLYL--GPLS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGAL 110

Query: 530 GFIIPEALNKFGANCGPEAVWFKTGALLLDGNTLNYFGNSIPINL--ILAVVA-EVVLVG 700
           G + PE L + G   G EAVWFK G+ +     L+Y GN   I+   ILA+   +VVL+G
Sbjct: 111 GCVFPELLARNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWGCQVVLMG 169

Query: 701 GAEYYRITNGL--EFDDKLHPGGPFDPLGLATDPDQAALLKVKEIKNGRLAMFSMLGFFI 874
             E YR+  G   E  D L+PGG FDPLGLA DP+  A LKVKEIKNGRLAMFSM GFF+
Sbjct: 170 AVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFV 229

Query: 875 QAYVTGEGPFENLCAHLSDPFGNN 946
           QA VTG+GP ENL  HL+DP  NN
Sbjct: 230 QAIVTGKGPLENLADHLADPVNNN 253
  9629.m03990|protein  Chlorophyll A-B binding protein, putative
           Length = 261
           
 Score =  221 bits (557), Expect = 3e-57
 Identities = 127/229 (55%), Positives = 148/229 (64%), Gaps = 5/229 (2%)
 Frame = +2

Query: 260 KKPAPKPKPAPVATSSAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 439
           +K A KPKPA   +           WYG DR +YL  G L   E P YL GE PGDYG+D
Sbjct: 30  RKSAAKPKPAASGSP----------WYGADRVLYL--GPLS-GEPPSYLTGEFPGDYGWD 76

Query: 440 PFGLGKKPEDFAKYQAFELIHARWAMLGAAGFIIPEALNKFGANCGPEAVWFKTGALLLD 619
             GL   PE FAK +  E+IH+RWAMLGA G + PE L + G   G EAVWFK G+ +  
Sbjct: 77  TAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGSQIFS 135

Query: 620 GNTLNYFGNSIPINL--ILAVVA-EVVLVGGAEYYRITNGL--EFDDKLHPGGPFDPLGL 784
              L+Y GN   I+   ILA+ A +VVL+G  E YRI  G   E  D L+PGG FDPLGL
Sbjct: 136 EGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGL 195

Query: 785 ATDPDQAALLKVKEIKNGRLAMFSMLGFFIQAYVTGEGPFENLCAHLSDPFGNN 946
           A DP+  A LKVKEIKNGRLAMFSM GFF+QA VTG+GP ENL  HL+DP  NN
Sbjct: 196 ADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 249
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97042309 Number of Sequences: 59712 Number of extensions: 3169824 Number of successful extensions: 37400 Number of sequences better than 1.0e-10: 38 Number of HSP's better than 0.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 37233 Number of HSP's gapped (non-prelim): 41 length of query: 479 length of database: 26,991,925 effective HSP length: 52 effective length of query: 426 effective length of database: 23,886,901 effective search space: 10175819826 effective search space used: 10175819826 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG823   Members:175            3pri:Y   1e-139      
P31923           Sucrose synthase 2 (Sucrose-UDP glucosyltransferase
2) pir||S32451 sucrose synthase (EC 2.4.1.13) Ss2 - barley
         (2846 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9635.m04256|protein  Sucrose synthase, putative                1569  0.0
 9631.m02804|protein  sucrose-UDP glucosyltransferase 2         1530  0.0
 9634.m00901|protein  sucrose synthase (EC 2.4.1.13) 1 - rice   1368  0.0
 9634.m00900|protein  sucrose synthase (EC 2.4.1.13) 1 - rice   1368  0.0
 9634.m00899|protein  sucrose synthase (EC 2.4.1.13) 1 - rice   1368  0.0
 9634.m00898|protein  sucrose synthase (EC 2.4.1.13) 1 - rice   1368  0.0
 9631.m02215|protein  sucrose synthase 3                        1174  0.0
 9631.m02214|protein  sucrose synthase 3                         979  0.0
 9630.m05839|protein  Sucrose synthase, putative                 878  0.0
 9632.m02280|protein  Sucrose synthase, putative                 864  0.0
 9632.m01596|protein  Sucrose synthase, putative                 864  0.0
 9636.m02033|protein  sucrose-phosphate synthase 1 (ec 2.4....   151  5e-36
 9636.m02032|protein  sucrose-phosphate synthase 1 (ec 2.4....   151  5e-36
 9630.m00828|protein  sucrose-phosphate synthase                 146  1e-34
 9630.m00829|protein  sucrose-phosphate synthase                 146  1e-34
 9629.m06860|protein  glycosyl transferase, group 1 family ...   143  2e-33
 9634.m04216|protein  sucrose-phosphate synthase                 141  4e-33
 9634.m00988|protein  hypothetical protein                        78  8e-14

  9635.m04256|protein  Sucrose synthase, putative
            Length = 816
            
 Score = 1569 bits (4018), Expect = 0.0
 Identities = 754/816 (92%), Positives = 788/816 (96%)
 Frame = +2

Query: 152  MGETAGERALSRVHSVRERIGDSLSAHTNELVAVFSRLVNQGKGMLQPHQITAEYNAAIP 331
            MGET GERAL+R+HS+RERIGDSLSAHTNELVAVFSRLVNQGKGMLQPHQI AEYNAAIP
Sbjct: 1    MGETTGERALTRLHSMRERIGDSLSAHTNELVAVFSRLVNQGKGMLQPHQIIAEYNAAIP 60

Query: 332  EAEREKLKNTPFEDLLRGAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELGVEELSVPEY 511
            E EREKLK++  ED+LRGAQEAIVIPPW+ALAIRPRPGVWEY+R+NVS+LGVEELSVPEY
Sbjct: 61   EGEREKLKDSALEDVLRGAQEAIVIPPWIALAIRPRPGVWEYLRINVSQLGVEELSVPEY 120

Query: 512  LQFKEQLANGSTDNNFVLELDFGPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESM 691
            LQFKEQL +GST NNFVLELDF PFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESM
Sbjct: 121  LQFKEQLVDGSTQNNFVLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESM 180

Query: 692  YPLLNFLRAHNYKGMTMMLNDRIRSLGTLQGALRKAETHLSGLPADTPYSEFHHRFQELG 871
            YPLLNFLRAHNYKGMTMMLNDRIRSL  LQGALRKAE HL+G+ ADTPYSEFHHRFQELG
Sbjct: 181  YPLLNFLRAHNYKGMTMMLNDRIRSLDALQGALRKAEKHLAGITADTPYSEFHHRFQELG 240

Query: 872  LEKGWGDCAQRASETIHLLLDLLEAPDPSSLEKFLGTIPMVFNVVILSPHGYFAQANVLG 1051
            LEKGWGDCAQR  ETIHLLLDLLEAP+PS+LEKFLGTIPMVFNVVILSPHGYFAQANVLG
Sbjct: 241  LEKGWGDCAQRVRETIHLLLDLLEAPEPSALEKFLGTIPMVFNVVILSPHGYFAQANVLG 300

Query: 1052 YPDTGGQVVYILDQVRAMENEMLLRIKQQGLDITPKILIVTRMLPDAHGTTCGQRLEKVL 1231
            YPDTGGQVVYILDQVRAMENEMLLRIKQQGL+ITP+ILIVTR+LPDAHGTTCGQRLEKVL
Sbjct: 301  YPDTGGQVVYILDQVRAMENEMLLRIKQQGLNITPRILIVTRLLPDAHGTTCGQRLEKVL 360

Query: 1232 GTEHTHILRVPFKTEDGIVRKWISRFEVWPYLEAYTDDVAHEIAGELQANPDLIIGNYSD 1411
            GTEHTHILRVPF+TE+G VRKWISRFEVWPYLE YTDDVAHEI+GELQA PDLIIGNYSD
Sbjct: 361  GTEHTHILRVPFRTENGTVRKWISRFEVWPYLETYTDDVAHEISGELQATPDLIIGNYSD 420

Query: 1412 GNLVACLLAHKLGVTHCTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTADLIAMNHADF 1591
            GNLVACLLAHKLGVTHCTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTADLIAMNHADF
Sbjct: 421  GNLVACLLAHKLGVTHCTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTADLIAMNHADF 480

Query: 1592 IITSTFQEIAGNKDTVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPYT 1771
            IITSTFQEIAGNK+TVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFP+T
Sbjct: 481  IITSTFQEIAGNKETVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPFT 540

Query: 1772 EQQKRLTSLHTEIEELLFSDVENAEHKFVLKDKKKPIIFSMARLDRVKNMTGLVEMYGRN 1951
            E QKRLTSLH EIEELLFSDVEN EHKFVLKDKKKPIIFSMARLD VKN+TGLVE+YGRN
Sbjct: 541  ESQKRLTSLHLEIEELLFSDVENTEHKFVLKDKKKPIIFSMARLDHVKNLTGLVELYGRN 600

Query: 1952 PRLQELVNLVVVCGDHGKVSKDKEEQAEFKKMFDLIEKYNLSGHIRWISAQMNRVRNGEL 2131
            PRLQELVNLVVVCGDHGK SKDKEEQAEFKKMF+LIE+YNL+GHIRWISAQMNRVRNGEL
Sbjct: 601  PRLQELVNLVVVCGDHGKESKDKEEQAEFKKMFNLIEQYNLNGHIRWISAQMNRVRNGEL 660

Query: 2132 YRYICDMKGAFVQPAFYEAFGLTVIEAMTCGLPTFATAYGGPAEIIVNGVSGYHIDPYQN 2311
            YRYICDM+GAFVQPA YEAFGLTVIEAMTCGLPTFATAYGGPAEIIV+GVSGYHIDPYQN
Sbjct: 661  YRYICDMRGAFVQPALYEAFGLTVIEAMTCGLPTFATAYGGPAEIIVHGVSGYHIDPYQN 720

Query: 2312 DKASALLVDFFGKCQEDPSHWNKISQGGLQRIEEKYTWKLYSERLMTLSGVYGFWKYVSN 2491
            DKASALLV+FF KCQEDP+HW KISQGGLQRIEEKYTWKLYSERLMTLSGVYGFWKYV+N
Sbjct: 721  DKASALLVEFFEKCQEDPNHWIKISQGGLQRIEEKYTWKLYSERLMTLSGVYGFWKYVTN 780

Query: 2492 LDRRETRRYLEMLYALKYRKMAATVPLAVEGETSGK 2599
            LDRRETRRYLEMLYALKYRKMA TVPLA+EGE S K
Sbjct: 781  LDRRETRRYLEMLYALKYRKMATTVPLAIEGEASTK 816
  9631.m02804|protein  sucrose-UDP glucosyltransferase 2
            Length = 816
            
 Score = 1530 bits (3918), Expect = 0.0
 Identities = 738/816 (90%), Positives = 775/816 (94%)
 Frame = +2

Query: 152  MGETAGERALSRVHSVRERIGDSLSAHTNELVAVFSRLVNQGKGMLQPHQITAEYNAAIP 331
            MGE AG+R LSR+HSVRERIGDSLSAH NELVAVF+RLVN GKGMLQ HQI AEYN AI 
Sbjct: 1    MGEAAGDRVLSRLHSVRERIGDSLSAHPNELVAVFTRLVNLGKGMLQAHQIIAEYNNAIS 60

Query: 332  EAEREKLKNTPFEDLLRGAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELGVEELSVPEY 511
            EA+REKLK+  FED+LR AQE IVI PWVALAIRPRPGVWEYVRVNVSEL VE L+VPEY
Sbjct: 61   EADREKLKDGAFEDVLRSAQEGIVISPWVALAIRPRPGVWEYVRVNVSELAVELLTVPEY 120

Query: 512  LQFKEQLANGSTDNNFVLELDFGPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESM 691
            LQFKEQL    T+NNFVLELDF PFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESM
Sbjct: 121  LQFKEQLVEEGTNNNFVLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESM 180

Query: 692  YPLLNFLRAHNYKGMTMMLNDRIRSLGTLQGALRKAETHLSGLPADTPYSEFHHRFQELG 871
            YPLLNFLRAHNYKGMTMMLNDRIRSL  LQGALRKAE HLSGL ADTPYSEFHHRFQELG
Sbjct: 181  YPLLNFLRAHNYKGMTMMLNDRIRSLSALQGALRKAEEHLSGLSADTPYSEFHHRFQELG 240

Query: 872  LEKGWGDCAQRASETIHLLLDLLEAPDPSSLEKFLGTIPMVFNVVILSPHGYFAQANVLG 1051
            LEKGWGDCA+R+ ETIHLLLDLLEAPDPS+LEKFLGTIPMVFNVVI+SPHGYFAQANVLG
Sbjct: 241  LEKGWGDCAKRSQETIHLLLDLLEAPDPSTLEKFLGTIPMVFNVVIMSPHGYFAQANVLG 300

Query: 1052 YPDTGGQVVYILDQVRAMENEMLLRIKQQGLDITPKILIVTRMLPDAHGTTCGQRLEKVL 1231
            YPDTGGQVVYILDQVRAMENEMLLRIKQQGL+ITP+ILIVTR+LPDA GTTCGQRLEKVL
Sbjct: 301  YPDTGGQVVYILDQVRAMENEMLLRIKQQGLNITPRILIVTRLLPDATGTTCGQRLEKVL 360

Query: 1232 GTEHTHILRVPFKTEDGIVRKWISRFEVWPYLEAYTDDVAHEIAGELQANPDLIIGNYSD 1411
            GTEHTHILRVPF+TE+GIVRKWISRFEVWPYLE +TDDVAHEIAGELQANPDLIIGNYSD
Sbjct: 361  GTEHTHILRVPFRTENGIVRKWISRFEVWPYLETFTDDVAHEIAGELQANPDLIIGNYSD 420

Query: 1412 GNLVACLLAHKLGVTHCTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTADLIAMNHADF 1591
            GNLVACLLAHK+GVTHCTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFT DLIAMNHADF
Sbjct: 421  GNLVACLLAHKMGVTHCTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTTDLIAMNHADF 480

Query: 1592 IITSTFQEIAGNKDTVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPYT 1771
            IITSTFQEIAGNKDTVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPY+
Sbjct: 481  IITSTFQEIAGNKDTVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPYS 540

Query: 1772 EQQKRLTSLHTEIEELLFSDVENAEHKFVLKDKKKPIIFSMARLDRVKNMTGLVEMYGRN 1951
            E +KRLTSLH EIEELL+S+V+N EHKF+LKD+ KPIIFSMARLDRVKN+TGLVE+YGRN
Sbjct: 541  ESRKRLTSLHPEIEELLYSEVDNNEHKFMLKDRNKPIIFSMARLDRVKNLTGLVELYGRN 600

Query: 1952 PRLQELVNLVVVCGDHGKVSKDKEEQAEFKKMFDLIEKYNLSGHIRWISAQMNRVRNGEL 2131
            PRLQELVNLVVVCGDHG  SKDKEEQAEFKKMFDLIE+YNL+GHIRWISAQMNRVRNGEL
Sbjct: 601  PRLQELVNLVVVCGDHGNPSKDKEEQAEFKKMFDLIEQYNLNGHIRWISAQMNRVRNGEL 660

Query: 2132 YRYICDMKGAFVQPAFYEAFGLTVIEAMTCGLPTFATAYGGPAEIIVNGVSGYHIDPYQN 2311
            YRYICD KGAFVQPAFYEAFGLTV+E+MTCGLPTFATAYGGPAEIIVNGVSG+HIDPYQ 
Sbjct: 661  YRYICDTKGAFVQPAFYEAFGLTVVESMTCGLPTFATAYGGPAEIIVNGVSGFHIDPYQG 720

Query: 2312 DKASALLVDFFGKCQEDPSHWNKISQGGLQRIEEKYTWKLYSERLMTLSGVYGFWKYVSN 2491
            DKASALLV+FF KCQEDPSHW KISQGGLQRIEEKYTWKLYSERLMTL+GVYGFWKYVSN
Sbjct: 721  DKASALLVEFFEKCQEDPSHWTKISQGGLQRIEEKYTWKLYSERLMTLTGVYGFWKYVSN 780

Query: 2492 LDRRETRRYLEMLYALKYRKMAATVPLAVEGETSGK 2599
            L+RRETRRYLEMLYALKYR MA+TVPLAVEGE S K
Sbjct: 781  LERRETRRYLEMLYALKYRTMASTVPLAVEGEPSNK 816
  9634.m00901|protein  sucrose synthase (EC 2.4.1.13) 1 - rice
            Length = 808
            
 Score = 1368 bits (3502), Expect = 0.0
 Identities = 651/807 (80%), Positives = 734/807 (90%)
 Frame = +2

Query: 179  LSRVHSVRERIGDSLSAHTNELVAVFSRLVNQGKGMLQPHQITAEYNAAIPEAEREKLKN 358
            L+R+HS+RER+G + S+H NEL+A+FSR VNQGKGMLQ HQ+ AE++A I   E +K K 
Sbjct: 5    LARLHSLRERLGATFSSHPNELIALFSRYVNQGKGMLQRHQLLAEFDALI---EADKEKY 61

Query: 359  TPFEDLLRGAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELGVEELSVPEYLQFKEQLAN 538
             PFED+LR AQEAIV+PPWVALAIRPRPGVW+Y+RVNVSEL VEELSV EYL FKEQL +
Sbjct: 62   APFEDILRAAQEAIVLPPWVALAIRPRPGVWDYIRVNVSELAVEELSVSEYLAFKEQLVD 121

Query: 539  GSTDNNFVLELDFGPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESMYPLLNFLRA 718
            G T++NFVLELDF PFNASFPRPS+SKSIGNGVQFLNRHLSSKLF DKES+YPLLNFL+A
Sbjct: 122  GHTNSNFVLELDFEPFNASFPRPSMSKSIGNGVQFLNRHLSSKLFQDKESLYPLLNFLKA 181

Query: 719  HNYKGMTMMLNDRIRSLGTLQGALRKAETHLSGLPADTPYSEFHHRFQELGLEKGWGDCA 898
            HN+KG TMMLNDRI+SL  LQ +LRKAE +L G+P DTPYSEF+HRFQELGLEKGWGDCA
Sbjct: 182  HNHKGTTMMLNDRIQSLRGLQSSLRKAEEYLMGIPQDTPYSEFNHRFQELGLEKGWGDCA 241

Query: 899  QRASETIHLLLDLLEAPDPSSLEKFLGTIPMVFNVVILSPHGYFAQANVLGYPDTGGQVV 1078
            +R  +TIHLLLDLLEAPDP++LEKFLGTIPM+FNVVILSPHGYFAQ+NVLGYPDTGGQVV
Sbjct: 242  KRVLDTIHLLLDLLEAPDPANLEKFLGTIPMMFNVVILSPHGYFAQSNVLGYPDTGGQVV 301

Query: 1079 YILDQVRAMENEMLLRIKQQGLDITPKILIVTRMLPDAHGTTCGQRLEKVLGTEHTHILR 1258
            YILDQVRA+ENEMLLRIKQQGLDITPKILIVTR+LPDA GTTCGQR+EKV+GTEHT ILR
Sbjct: 302  YILDQVRALENEMLLRIKQQGLDITPKILIVTRLLPDAVGTTCGQRVEKVIGTEHTDILR 361

Query: 1259 VPFKTEDGIVRKWISRFEVWPYLEAYTDDVAHEIAGELQANPDLIIGNYSDGNLVACLLA 1438
            VPF++E+GI+RKWISRF+VWP+LE YT+DVA+EI  E+QA PDLIIGNYSDGNLVA LLA
Sbjct: 362  VPFRSENGILRKWISRFDVWPFLETYTEDVANEIMREMQAKPDLIIGNYSDGNLVATLLA 421

Query: 1439 HKLGVTHCTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTADLIAMNHADFIITSTFQEI 1618
            HKLGVT CTIAHALEKTKYPNSD+Y  KF+  YHFSCQFTADLIAMNH DFIITSTFQEI
Sbjct: 422  HKLGVTQCTIAHALEKTKYPNSDIYLDKFDSQYHFSCQFTADLIAMNHTDFIITSTFQEI 481

Query: 1619 AGNKDTVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPYTEQQKRLTSL 1798
            AG+KDTVGQYESH+AFT+PGLYRVVHGIDVFDPKFNIVSPGADMS+YFPYTE  KRLT+ 
Sbjct: 482  AGSKDTVGQYESHIAFTLPGLYRVVHGIDVFDPKFNIVSPGADMSVYFPYTEADKRLTAF 541

Query: 1799 HTEIEELLFSDVENAEHKFVLKDKKKPIIFSMARLDRVKNMTGLVEMYGRNPRLQELVNL 1978
            H EIEELL+S+VEN EHKFVLKDK KPIIFSMARLDRVKNMTGLVEMYG+N  L++L NL
Sbjct: 542  HPEIEELLYSEVENDEHKFVLKDKNKPIIFSMARLDRVKNMTGLVEMYGKNAHLRDLANL 601

Query: 1979 VVVCGDHGKVSKDKEEQAEFKKMFDLIEKYNLSGHIRWISAQMNRVRNGELYRYICDMKG 2158
            V+VCGDHG  SKD+EEQAEFKKM+ LI++Y L GHIRWISAQMNRVRNGELYRYICD KG
Sbjct: 602  VIVCGDHGNQSKDREEQAEFKKMYGLIDQYKLKGHIRWISAQMNRVRNGELYRYICDTKG 661

Query: 2159 AFVQPAFYEAFGLTVIEAMTCGLPTFATAYGGPAEIIVNGVSGYHIDPYQNDKASALLVD 2338
             FVQPAFYEAFGLTVIEAMTCGLPT AT +GGPAEIIV+GVSG HIDPY +DKA+ +LV+
Sbjct: 662  VFVQPAFYEAFGLTVIEAMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVN 721

Query: 2339 FFGKCQEDPSHWNKISQGGLQRIEEKYTWKLYSERLMTLSGVYGFWKYVSNLDRRETRRY 2518
            FF KC++D ++W+ ISQGGLQRI EKYTWKLYSERLMTL+GVYGFWKYVSNL+RRETRRY
Sbjct: 722  FFEKCKQDSTYWDNISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRY 781

Query: 2519 LEMLYALKYRKMAATVPLAVEGETSGK 2599
            +EM YALKYR +A+ VPLAV+GE++ K
Sbjct: 782  IEMFYALKYRSLASAVPLAVDGESTSK 808
  9634.m00900|protein  sucrose synthase (EC 2.4.1.13) 1 - rice
            Length = 808
            
 Score = 1368 bits (3502), Expect = 0.0
 Identities = 651/807 (80%), Positives = 734/807 (90%)
 Frame = +2

Query: 179  LSRVHSVRERIGDSLSAHTNELVAVFSRLVNQGKGMLQPHQITAEYNAAIPEAEREKLKN 358
            L+R+HS+RER+G + S+H NEL+A+FSR VNQGKGMLQ HQ+ AE++A I   E +K K 
Sbjct: 5    LARLHSLRERLGATFSSHPNELIALFSRYVNQGKGMLQRHQLLAEFDALI---EADKEKY 61

Query: 359  TPFEDLLRGAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELGVEELSVPEYLQFKEQLAN 538
             PFED+LR AQEAIV+PPWVALAIRPRPGVW+Y+RVNVSEL VEELSV EYL FKEQL +
Sbjct: 62   APFEDILRAAQEAIVLPPWVALAIRPRPGVWDYIRVNVSELAVEELSVSEYLAFKEQLVD 121

Query: 539  GSTDNNFVLELDFGPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESMYPLLNFLRA 718
            G T++NFVLELDF PFNASFPRPS+SKSIGNGVQFLNRHLSSKLF DKES+YPLLNFL+A
Sbjct: 122  GHTNSNFVLELDFEPFNASFPRPSMSKSIGNGVQFLNRHLSSKLFQDKESLYPLLNFLKA 181

Query: 719  HNYKGMTMMLNDRIRSLGTLQGALRKAETHLSGLPADTPYSEFHHRFQELGLEKGWGDCA 898
            HN+KG TMMLNDRI+SL  LQ +LRKAE +L G+P DTPYSEF+HRFQELGLEKGWGDCA
Sbjct: 182  HNHKGTTMMLNDRIQSLRGLQSSLRKAEEYLMGIPQDTPYSEFNHRFQELGLEKGWGDCA 241

Query: 899  QRASETIHLLLDLLEAPDPSSLEKFLGTIPMVFNVVILSPHGYFAQANVLGYPDTGGQVV 1078
            +R  +TIHLLLDLLEAPDP++LEKFLGTIPM+FNVVILSPHGYFAQ+NVLGYPDTGGQVV
Sbjct: 242  KRVLDTIHLLLDLLEAPDPANLEKFLGTIPMMFNVVILSPHGYFAQSNVLGYPDTGGQVV 301

Query: 1079 YILDQVRAMENEMLLRIKQQGLDITPKILIVTRMLPDAHGTTCGQRLEKVLGTEHTHILR 1258
            YILDQVRA+ENEMLLRIKQQGLDITPKILIVTR+LPDA GTTCGQR+EKV+GTEHT ILR
Sbjct: 302  YILDQVRALENEMLLRIKQQGLDITPKILIVTRLLPDAVGTTCGQRVEKVIGTEHTDILR 361

Query: 1259 VPFKTEDGIVRKWISRFEVWPYLEAYTDDVAHEIAGELQANPDLIIGNYSDGNLVACLLA 1438
            VPF++E+GI+RKWISRF+VWP+LE YT+DVA+EI  E+QA PDLIIGNYSDGNLVA LLA
Sbjct: 362  VPFRSENGILRKWISRFDVWPFLETYTEDVANEIMREMQAKPDLIIGNYSDGNLVATLLA 421

Query: 1439 HKLGVTHCTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTADLIAMNHADFIITSTFQEI 1618
            HKLGVT CTIAHALEKTKYPNSD+Y  KF+  YHFSCQFTADLIAMNH DFIITSTFQEI
Sbjct: 422  HKLGVTQCTIAHALEKTKYPNSDIYLDKFDSQYHFSCQFTADLIAMNHTDFIITSTFQEI 481

Query: 1619 AGNKDTVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPYTEQQKRLTSL 1798
            AG+KDTVGQYESH+AFT+PGLYRVVHGIDVFDPKFNIVSPGADMS+YFPYTE  KRLT+ 
Sbjct: 482  AGSKDTVGQYESHIAFTLPGLYRVVHGIDVFDPKFNIVSPGADMSVYFPYTEADKRLTAF 541

Query: 1799 HTEIEELLFSDVENAEHKFVLKDKKKPIIFSMARLDRVKNMTGLVEMYGRNPRLQELVNL 1978
            H EIEELL+S+VEN EHKFVLKDK KPIIFSMARLDRVKNMTGLVEMYG+N  L++L NL
Sbjct: 542  HPEIEELLYSEVENDEHKFVLKDKNKPIIFSMARLDRVKNMTGLVEMYGKNAHLRDLANL 601

Query: 1979 VVVCGDHGKVSKDKEEQAEFKKMFDLIEKYNLSGHIRWISAQMNRVRNGELYRYICDMKG 2158
            V+VCGDHG  SKD+EEQAEFKKM+ LI++Y L GHIRWISAQMNRVRNGELYRYICD KG
Sbjct: 602  VIVCGDHGNQSKDREEQAEFKKMYGLIDQYKLKGHIRWISAQMNRVRNGELYRYICDTKG 661

Query: 2159 AFVQPAFYEAFGLTVIEAMTCGLPTFATAYGGPAEIIVNGVSGYHIDPYQNDKASALLVD 2338
             FVQPAFYEAFGLTVIEAMTCGLPT AT +GGPAEIIV+GVSG HIDPY +DKA+ +LV+
Sbjct: 662  VFVQPAFYEAFGLTVIEAMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVN 721

Query: 2339 FFGKCQEDPSHWNKISQGGLQRIEEKYTWKLYSERLMTLSGVYGFWKYVSNLDRRETRRY 2518
            FF KC++D ++W+ ISQGGLQRI EKYTWKLYSERLMTL+GVYGFWKYVSNL+RRETRRY
Sbjct: 722  FFEKCKQDSTYWDNISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRY 781

Query: 2519 LEMLYALKYRKMAATVPLAVEGETSGK 2599
            +EM YALKYR +A+ VPLAV+GE++ K
Sbjct: 782  IEMFYALKYRSLASAVPLAVDGESTSK 808
  9634.m00899|protein  sucrose synthase (EC 2.4.1.13) 1 - rice
            Length = 808
            
 Score = 1368 bits (3502), Expect = 0.0
 Identities = 651/807 (80%), Positives = 734/807 (90%)
 Frame = +2

Query: 179  LSRVHSVRERIGDSLSAHTNELVAVFSRLVNQGKGMLQPHQITAEYNAAIPEAEREKLKN 358
            L+R+HS+RER+G + S+H NEL+A+FSR VNQGKGMLQ HQ+ AE++A I   E +K K 
Sbjct: 5    LARLHSLRERLGATFSSHPNELIALFSRYVNQGKGMLQRHQLLAEFDALI---EADKEKY 61

Query: 359  TPFEDLLRGAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELGVEELSVPEYLQFKEQLAN 538
             PFED+LR AQEAIV+PPWVALAIRPRPGVW+Y+RVNVSEL VEELSV EYL FKEQL +
Sbjct: 62   APFEDILRAAQEAIVLPPWVALAIRPRPGVWDYIRVNVSELAVEELSVSEYLAFKEQLVD 121

Query: 539  GSTDNNFVLELDFGPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESMYPLLNFLRA 718
            G T++NFVLELDF PFNASFPRPS+SKSIGNGVQFLNRHLSSKLF DKES+YPLLNFL+A
Sbjct: 122  GHTNSNFVLELDFEPFNASFPRPSMSKSIGNGVQFLNRHLSSKLFQDKESLYPLLNFLKA 181

Query: 719  HNYKGMTMMLNDRIRSLGTLQGALRKAETHLSGLPADTPYSEFHHRFQELGLEKGWGDCA 898
            HN+KG TMMLNDRI+SL  LQ +LRKAE +L G+P DTPYSEF+HRFQELGLEKGWGDCA
Sbjct: 182  HNHKGTTMMLNDRIQSLRGLQSSLRKAEEYLMGIPQDTPYSEFNHRFQELGLEKGWGDCA 241

Query: 899  QRASETIHLLLDLLEAPDPSSLEKFLGTIPMVFNVVILSPHGYFAQANVLGYPDTGGQVV 1078
            +R  +TIHLLLDLLEAPDP++LEKFLGTIPM+FNVVILSPHGYFAQ+NVLGYPDTGGQVV
Sbjct: 242  KRVLDTIHLLLDLLEAPDPANLEKFLGTIPMMFNVVILSPHGYFAQSNVLGYPDTGGQVV 301

Query: 1079 YILDQVRAMENEMLLRIKQQGLDITPKILIVTRMLPDAHGTTCGQRLEKVLGTEHTHILR 1258
            YILDQVRA+ENEMLLRIKQQGLDITPKILIVTR+LPDA GTTCGQR+EKV+GTEHT ILR
Sbjct: 302  YILDQVRALENEMLLRIKQQGLDITPKILIVTRLLPDAVGTTCGQRVEKVIGTEHTDILR 361

Query: 1259 VPFKTEDGIVRKWISRFEVWPYLEAYTDDVAHEIAGELQANPDLIIGNYSDGNLVACLLA 1438
            VPF++E+GI+RKWISRF+VWP+LE YT+DVA+EI  E+QA PDLIIGNYSDGNLVA LLA
Sbjct: 362  VPFRSENGILRKWISRFDVWPFLETYTEDVANEIMREMQAKPDLIIGNYSDGNLVATLLA 421

Query: 1439 HKLGVTHCTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTADLIAMNHADFIITSTFQEI 1618
            HKLGVT CTIAHALEKTKYPNSD+Y  KF+  YHFSCQFTADLIAMNH DFIITSTFQEI
Sbjct: 422  HKLGVTQCTIAHALEKTKYPNSDIYLDKFDSQYHFSCQFTADLIAMNHTDFIITSTFQEI 481

Query: 1619 AGNKDTVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPYTEQQKRLTSL 1798
            AG+KDTVGQYESH+AFT+PGLYRVVHGIDVFDPKFNIVSPGADMS+YFPYTE  KRLT+ 
Sbjct: 482  AGSKDTVGQYESHIAFTLPGLYRVVHGIDVFDPKFNIVSPGADMSVYFPYTEADKRLTAF 541

Query: 1799 HTEIEELLFSDVENAEHKFVLKDKKKPIIFSMARLDRVKNMTGLVEMYGRNPRLQELVNL 1978
            H EIEELL+S+VEN EHKFVLKDK KPIIFSMARLDRVKNMTGLVEMYG+N  L++L NL
Sbjct: 542  HPEIEELLYSEVENDEHKFVLKDKNKPIIFSMARLDRVKNMTGLVEMYGKNAHLRDLANL 601

Query: 1979 VVVCGDHGKVSKDKEEQAEFKKMFDLIEKYNLSGHIRWISAQMNRVRNGELYRYICDMKG 2158
            V+VCGDHG  SKD+EEQAEFKKM+ LI++Y L GHIRWISAQMNRVRNGELYRYICD KG
Sbjct: 602  VIVCGDHGNQSKDREEQAEFKKMYGLIDQYKLKGHIRWISAQMNRVRNGELYRYICDTKG 661

Query: 2159 AFVQPAFYEAFGLTVIEAMTCGLPTFATAYGGPAEIIVNGVSGYHIDPYQNDKASALLVD 2338
             FVQPAFYEAFGLTVIEAMTCGLPT AT +GGPAEIIV+GVSG HIDPY +DKA+ +LV+
Sbjct: 662  VFVQPAFYEAFGLTVIEAMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVN 721

Query: 2339 FFGKCQEDPSHWNKISQGGLQRIEEKYTWKLYSERLMTLSGVYGFWKYVSNLDRRETRRY 2518
            FF KC++D ++W+ ISQGGLQRI EKYTWKLYSERLMTL+GVYGFWKYVSNL+RRETRRY
Sbjct: 722  FFEKCKQDSTYWDNISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRY 781

Query: 2519 LEMLYALKYRKMAATVPLAVEGETSGK 2599
            +EM YALKYR +A+ VPLAV+GE++ K
Sbjct: 782  IEMFYALKYRSLASAVPLAVDGESTSK 808
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 182224294 Number of Sequences: 59712 Number of extensions: 5119071 Number of successful extensions: 19385 Number of sequences better than 1.0e-10: 36 Number of HSP's better than 0.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 19317 Number of HSP's gapped (non-prelim): 29 length of query: 948 length of database: 26,991,925 effective HSP length: 54 effective length of query: 894 effective length of database: 23,767,477 effective search space: 21248124438 effective search space used: 21248124438 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 163 (67.9 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG838   Members:576            3pri:Y   3e-94       
BAB19812.1       ribulose-1,5-bisphosphate carboxylase/oxygenase small
subunit [Triticum aestivum]
         (827 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9640.m01919|protein  Ribulose bisphosphate carboxylase, sm...   316  3e-86
 9640.m01915|protein  Ribulose bisphosphate carboxylase, sm...   312  4e-85
 9640.m01725|protein  Ribulose bisphosphate carboxylase, sm...   311  1e-84
 9640.m01925|protein  Ribulose bisphosphate carboxylase, sm...   308  1e-83
 9640.m01916|protein  Ribulose bisphosphate carboxylase, sm...   241  1e-63
 9640.m01926|protein  Ribulose bisphosphate carboxylase, sm...   239  6e-63
 9640.m01917|protein  Ribulose bisphosphate carboxylase, sm...   184  1e-46
 9630.m00509|protein  Ribulose bisphosphate carboxylase, sm...   177  2e-44

  9640.m01919|protein  Ribulose bisphosphate carboxylase, small
           subunit, putative
           Length = 175
           
 Score =  316 bits (802), Expect = 3e-86
 Identities = 147/174 (84%), Positives = 164/174 (93%)
 Frame = +2

Query: 56  MAPTVMSSAATAVAPFQGLKSTAGLPVSRLSGNAAGLGSVSNGGRIRCMQVWPIEGIKKF 235
           MAPTVM+S+AT+VAPFQGLKSTAGLPVSR S N+AGLGSVSNGGRI CMQVWPIEGIKKF
Sbjct: 1   MAPTVMASSATSVAPFQGLKSTAGLPVSRRS-NSAGLGSVSNGGRISCMQVWPIEGIKKF 59

Query: 236 ETLSYLPPLSTEALLKQVDYLIRSKWVPCLEFSKVGFIFREHNASPGYYDGRYWTMWKLP 415
           ETLSYLPPL+ E LLKQ++YL+RSKWVPCLEFSKVGF++RE++ SPGYYDGRYWTMWKLP
Sbjct: 60  ETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLP 119

Query: 416 MFGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 577
           MFGCTDATQVL E+EE KK YPDA+VRIIGFDN+RQVQ +SFIA+KPPGCEESG
Sbjct: 120 MFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
  9640.m01915|protein  Ribulose bisphosphate carboxylase, small
           subunit
           Length = 175
           
 Score =  312 bits (792), Expect = 4e-85
 Identities = 144/174 (82%), Positives = 163/174 (92%)
 Frame = +2

Query: 56  MAPTVMSSAATAVAPFQGLKSTAGLPVSRLSGNAAGLGSVSNGGRIRCMQVWPIEGIKKF 235
           MAPTVM+S+AT+VAPFQGLKSTAGLPVSR S N+ G G+VSNGGRI+CMQVWPIEGIKKF
Sbjct: 1   MAPTVMASSATSVAPFQGLKSTAGLPVSRRSTNS-GFGNVSNGGRIKCMQVWPIEGIKKF 59

Query: 236 ETLSYLPPLSTEALLKQVDYLIRSKWVPCLEFSKVGFIFREHNASPGYYDGRYWTMWKLP 415
           ETLSYLPPL+ E LLKQ++YL+RSKWVPCLEFSKVGF++RE++ SPGYYDGRYWTMWKLP
Sbjct: 60  ETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLP 119

Query: 416 MFGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 577
           MFGCTDATQVL E+EE KK YPDA+VRIIGFDN+RQVQ +SFIA+KPPGCEESG
Sbjct: 120 MFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
  9640.m01725|protein  Ribulose bisphosphate carboxylase, small
           subunit, putative
           Length = 175
           
 Score =  311 bits (788), Expect = 1e-84
 Identities = 142/174 (81%), Positives = 163/174 (93%)
 Frame = +2

Query: 56  MAPTVMSSAATAVAPFQGLKSTAGLPVSRLSGNAAGLGSVSNGGRIRCMQVWPIEGIKKF 235
           MAP+VM+S+AT VAPFQGLKSTAG+PV+R SGN++  G+VSNGGRIRCMQVWPIEGIKKF
Sbjct: 1   MAPSVMASSATTVAPFQGLKSTAGMPVARRSGNSS-FGNVSNGGRIRCMQVWPIEGIKKF 59

Query: 236 ETLSYLPPLSTEALLKQVDYLIRSKWVPCLEFSKVGFIFREHNASPGYYDGRYWTMWKLP 415
           ETLSYLPPL+ E LLKQ++YL+RSKWVPCLEFSKVGF++RE++ SPGYYDGRYWTMWKLP
Sbjct: 60  ETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLP 119

Query: 416 MFGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 577
           MFGCTDATQVL E+EE KK YPDA+VRIIGFDN+RQVQ +SFIA+KPPGCEESG
Sbjct: 120 MFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
  9640.m01925|protein  Ribulose bisphosphate carboxylase, small
           subunit, putative
           Length = 175
           
 Score =  308 bits (780), Expect = 1e-83
 Identities = 141/174 (81%), Positives = 163/174 (93%)
 Frame = +2

Query: 56  MAPTVMSSAATAVAPFQGLKSTAGLPVSRLSGNAAGLGSVSNGGRIRCMQVWPIEGIKKF 235
           MAP+VM+S+AT+VAPFQGLKSTAGLPV+R S +++  G+VSNGGRIRCMQVWPIEGIKKF
Sbjct: 1   MAPSVMASSATSVAPFQGLKSTAGLPVNRRSSSSS-FGNVSNGGRIRCMQVWPIEGIKKF 59

Query: 236 ETLSYLPPLSTEALLKQVDYLIRSKWVPCLEFSKVGFIFREHNASPGYYDGRYWTMWKLP 415
           ETLSYLPPL+ E LLKQ++YL+RSKWVPCLEFSKVGF++RE++ SPGYYDGRYWTMWKLP
Sbjct: 60  ETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLP 119

Query: 416 MFGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 577
           MFGCTDATQVL E+EE KK YPDA+VRIIGFDN+RQVQ +SFIA+KPPGCEESG
Sbjct: 120 MFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
  9640.m01916|protein  Ribulose bisphosphate carboxylase, small
           subunit
           Length = 128
           
 Score =  241 bits (608), Expect = 1e-63
 Identities = 106/126 (84%), Positives = 119/126 (94%)
 Frame = +2

Query: 200 MQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPCLEFSKVGFIFREHNASPGY 379
           MQVWPIEGIKKFETLSYLPPL+ E LLKQ++YL+RSKWVPCLEFSKVGF++RE++ SPGY
Sbjct: 1   MQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGY 60

Query: 380 YDGRYWTMWKLPMFGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 559
           YDGRYWTMWKLPMFGCTDATQVL E+EE KK YPDA+VRIIGFDN+RQVQ +SFIA+KPP
Sbjct: 61  YDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPP 120

Query: 560 GCEESG 577
           GCEESG
Sbjct: 121 GCEESG 126
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52093293 Number of Sequences: 59712 Number of extensions: 1389269 Number of successful extensions: 6980 Number of sequences better than 1.0e-10: 16 Number of HSP's better than 0.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6966 Number of HSP's gapped (non-prelim): 9 length of query: 275 length of database: 26,991,925 effective HSP length: 50 effective length of query: 225 effective length of database: 24,006,325 effective search space: 5401423125 effective search space used: 5401423125 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 157 (65.6 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG841   Members:30             3pri:Y   1e-120      
AAB18209.1       chlorophyll a/b-binding protein WCAB precursor
[Triticum aestivum]
         (967 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9629.m03990|protein  Chlorophyll A-B binding protein, puta...   496  e-140
 9629.m05067|protein  Chlorophyll A-B binding protein, puta...   495  e-140
 9637.m01516|protein  chlorophyll a/b-binding protein I pre...   492  e-139
 9631.m03807|protein  chlorophyll a/b binding protein            414  e-115
 9635.m03724|protein  chlorophyll a-b binding protein of lh...   341  1e-93
 9637.m00977|protein  Chlorophyll A-B binding protein, puta...   219  5e-57
 9639.m01284|protein  chlorophyll a/b-binding protein CP26 ...   214  2e-55
 9634.m02114|protein  chlorophyll a/b-binding protein precu...   141  2e-33
 9635.m03882|protein  LHCI-680, photosystem I antenna prote...   139  7e-33
 9630.m05194|protein  light-harvesting complex protein [imp...   129  8e-30
 9630.m00958|protein  chlorophyll a/b-binding protein type ...   126  5e-29
 9637.m02343|protein  AY086461 PSI type II chlorophyll a/b-...   123  6e-28
 9639.m01283|protein  chlorophyll a/b-binding protein CP26 ...   117  3e-26
 9635.m03689|protein  probable chlorophyll a/b-binding prot...   116  7e-26
 9632.m03624|protein  chlorophyll a/b-binding apoprotein CP...    82  2e-15
 9630.m00957|protein  chlorophyll a/b-binding protein type ...    80  6e-15

  9629.m03990|protein  Chlorophyll A-B binding protein, putative
           Length = 261
           
 Score =  496 bits (1263), Expect = e-140
 Identities = 238/266 (89%), Positives = 249/266 (93%)
 Frame = +1

Query: 40  MAAATMSISSSTFAGKAVKNVPSLALFGEARVTMRKTAAKAKQVSSGSPWYGADRVLYLG 219
           MAAATM++SS   AGKA   V     FGE R+TMRK+AAK K  +SGSPWYGADRVLYLG
Sbjct: 1   MAAATMALSSPALAGKAAAKV-----FGEGRITMRKSAAKPKPAASGSPWYGADRVLYLG 55

Query: 220 PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA 399
           PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLA
Sbjct: 56  PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLA 115

Query: 400 RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG 579
           RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGG
Sbjct: 116 RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGG 175

Query: 580 PLGEIIDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 759
           PLGE++DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL
Sbjct: 176 PLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 235

Query: 760 ENLADHIADPVNNNAWAFATNFVPGK 837
           ENLADH+ADPVNNNAWA+ATNFVPGK
Sbjct: 236 ENLADHLADPVNNNAWAYATNFVPGK 261
  9629.m05067|protein  Chlorophyll A-B binding protein, putative
           Length = 265
           
 Score =  495 bits (1262), Expect = e-140
 Identities = 239/266 (89%), Positives = 253/266 (94%), Gaps = 2/266 (0%)
 Frame = +1

Query: 40  MAAATMSISS-STFAGKAVKNVPSLALFGEARVTMRKTAAKAKQVS-SGSPWYGADRVLY 213
           MAA+TM++SS +  AGKAV N     +FGE RVTMRK+AAK K  + SGSPWYGADRVLY
Sbjct: 1   MAASTMALSSPAALAGKAVANAK---VFGEGRVTMRKSAAKPKPAAASGSPWYGADRVLY 57

Query: 214 LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL 393
           LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL
Sbjct: 58  LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL 117

Query: 394 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIA 573
           LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIW CQVVLMGAVEGYR+A
Sbjct: 118 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWGCQVVLMGAVEGYRVA 177

Query: 574 GGPLGEIIDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 753
           GGPLGE++DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG
Sbjct: 178 GGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 237

Query: 754 PLENLADHIADPVNNNAWAFATNFVPGK 837
           PLENLADH+ADPVNNNAWA+ATNFVPGK
Sbjct: 238 PLENLADHLADPVNNNAWAYATNFVPGK 265
  9637.m01516|protein  chlorophyll a/b-binding protein I precursor -
           rice
           Length = 265
           
 Score =  492 bits (1253), Expect = e-139
 Identities = 240/266 (90%), Positives = 250/266 (93%), Gaps = 1/266 (0%)
 Frame = +1

Query: 40  MAAATMSISSSTFAGKAVKNVPSLALFGEARVTMRKTAAKAKQV-SSGSPWYGADRVLYL 216
           MAAATM++SS   A  A     S ALFGEAR+TMRKTAAK K   SSGSPWYGADRVLYL
Sbjct: 1   MAAATMALSSPVMARAAPST--SSALFGEARITMRKTAAKPKPAASSGSPWYGADRVLYL 58

Query: 217 GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELL 396
           GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL
Sbjct: 59  GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL 118

Query: 397 ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAG 576
           ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAG
Sbjct: 119 ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAG 178

Query: 577 GPLGEIIDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 756
           GPLGE++DPLYPGG+FDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP
Sbjct: 179 GPLGEVVDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 238

Query: 757 LENLADHIADPVNNNAWAFATNFVPGK 837
           LENLADH+ADPVNNNAWA+ATNFVPGK
Sbjct: 239 LENLADHLADPVNNNAWAYATNFVPGK 265
  9631.m03807|protein  chlorophyll a/b binding protein
           Length = 263
           
 Score =  414 bits (1053), Expect = e-115
 Identities = 199/264 (75%), Positives = 226/264 (85%), Gaps = 2/264 (0%)
 Frame = +1

Query: 46  AATMSISSSTFAGKAVKNVPSLALFGEA--RVTMRKTAAKAKQVSSGSPWYGADRVLYLG 219
           AA+    +++F G A +    +   G++  R+TMR+T   A Q    S WYG DR  YLG
Sbjct: 2   AASALHQTTSFLGTAPRRDELVRRVGDSGGRITMRRTVKSAPQ----SIWYGPDRPKYLG 57

Query: 220 PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA 399
           P S + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+
Sbjct: 58  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS 117

Query: 400 RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG 579
           +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LVHAQSILAIWA QVVLMG VEGYR+ GG
Sbjct: 118 KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG 177

Query: 580 PLGEIIDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 759
           PLGE +D +YPGG+FDPLGLA+DP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+
Sbjct: 178 PLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI 237

Query: 760 ENLADHIADPVNNNAWAFATNFVPGK 837
           ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct: 238 ENLFDHVADPVANNAWAYATNFVPGK 263
  9635.m03724|protein  chlorophyll a-b binding protein of lhcii type
           iii, chloroplastprecursor (cab)
           Length = 266
           
 Score =  341 bits (865), Expect = 1e-93
 Identities = 180/265 (67%), Positives = 199/265 (74%), Gaps = 4/265 (1%)
 Frame = +1

Query: 40  MAAATMSISSSTFAGKAVKNVPSLALFGEARVTMRKTAAKA--KQVSSGSPWYGADRVLY 213
           MA+  M+ +S   A K     P L     +   +R  AA A  +   S   WYG DRV Y
Sbjct: 1   MASTIMAPTSRVLAAKT----PFLGHPRPSNAPVRDIAAAATGRITMSKELWYGPDRVKY 56

Query: 214 LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL 393
           LGP S + PSYL GEFPGDYGWDTAGLSADPE FA+NR LEVIH RWAMLGALGC+ PE+
Sbjct: 57  LGPFSAQTPSYLRGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCITPEV 116

Query: 394 LAR-NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRI 570
           L +   V F E VWFKAG+QIFS+GGLDYLGNP+LVHAQSILA+   QVVLMG VEGYRI
Sbjct: 117 LEKWVRVDFKEPVWFKAGAQIFSDGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGYRI 176

Query: 571 AGGPLGEIIDPLYPGGS-FDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTG 747
            G P     + LYPGG  FDPLGLA+DP  FAELKVKEIKNGRLAMFSMFGFFVQAIVTG
Sbjct: 177 NGLPGVGDGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTG 236

Query: 748 KGPLENLADHIADPVNNNAWAFATNFVPG 834
           KGPLENL DH+ADPV NNAW +AT F PG
Sbjct: 237 KGPLENLLDHLADPVANNAWVYATKFTPG 265
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69568812 Number of Sequences: 59712 Number of extensions: 2128831 Number of successful extensions: 11083 Number of sequences better than 1.0e-10: 32 Number of HSP's better than 0.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 11030 Number of HSP's gapped (non-prelim): 19 length of query: 322 length of database: 26,991,925 effective HSP length: 51 effective length of query: 270 effective length of database: 23,946,613 effective search space: 6465585510 effective search space used: 6465585510 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG853   Members:446            3pri:Y   1e-125      
AAH53854.1       Unknown (protein for IMAGE:5194336) [Homo sapiens]
         (1227 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9629.m05067|protein  Chlorophyll A-B binding protein, puta...   495  e-140
 9629.m03990|protein  Chlorophyll A-B binding protein, puta...   494  e-139
 9637.m01516|protein  chlorophyll a/b-binding protein I pre...   491  e-139
 9631.m03807|protein  chlorophyll a/b binding protein            411  e-114
 9635.m03724|protein  chlorophyll a-b binding protein of lh...   344  3e-94
 9639.m01284|protein  chlorophyll a/b-binding protein CP26 ...   220  3e-57
 9637.m00977|protein  Chlorophyll A-B binding protein, puta...   219  6e-57
 9634.m02114|protein  chlorophyll a/b-binding protein precu...   142  1e-33
 9635.m03882|protein  LHCI-680, photosystem I antenna prote...   141  2e-33
 9630.m05194|protein  light-harvesting complex protein [imp...   134  4e-31
 9630.m00958|protein  chlorophyll a/b-binding protein type ...   125  2e-28
 9637.m02343|protein  AY086461 PSI type II chlorophyll a/b-...   124  3e-28
 9639.m01283|protein  chlorophyll a/b-binding protein CP26 ...   123  8e-28
 9635.m03689|protein  probable chlorophyll a/b-binding prot...   116  6e-26
 9632.m03624|protein  chlorophyll a/b-binding apoprotein CP...    81  4e-15
 9630.m00957|protein  chlorophyll a/b-binding protein type ...    78  4e-14
 9629.m00408|protein  expressed protein                           68  3e-11

  9629.m05067|protein  Chlorophyll A-B binding protein, putative
           Length = 265
           
 Score =  495 bits (1260), Expect = e-140
 Identities = 240/266 (90%), Positives = 254/266 (95%), Gaps = 2/266 (0%)
 Frame = +2

Query: 86  MATTAMALSS-SSFAGKAVKDLPSSALFGEARVTMRKTAAKAKPVSSS-SPWYGSDRVLY 259
           MA + MALSS ++ AGKAV +   + +FGE RVTMRK+AAK KP ++S SPWYG+DRVLY
Sbjct: 1   MAASTMALSSPAALAGKAVAN---AKVFGEGRVTMRKSAAKPKPAAASGSPWYGADRVLY 57

Query: 260 LGPLSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL 439
           LGPLSG+PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL
Sbjct: 58  LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL 117

Query: 440 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVA 619
           LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIW CQVVLMGAVEGYRVA
Sbjct: 118 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWGCQVVLMGAVEGYRVA 177

Query: 620 GGPLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 799
           GGPLGE+VDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG
Sbjct: 178 GGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 237

Query: 800 PLENLADHLADPVNNNAWAFATNFVPGK 883
           PLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct: 238 PLENLADHLADPVNNNAWAYATNFVPGK 265
  9629.m03990|protein  Chlorophyll A-B binding protein, putative
           Length = 261
           
 Score =  494 bits (1257), Expect = e-139
 Identities = 236/266 (88%), Positives = 249/266 (92%)
 Frame = +2

Query: 86  MATTAMALSSSSFAGKAVKDLPSSALFGEARVTMRKTAAKAKPVSSSSPWYGSDRVLYLG 265
           MA   MALSS + AGKA     ++ +FGE R+TMRK+AAK KP +S SPWYG+DRVLYLG
Sbjct: 1   MAAATMALSSPALAGKA-----AAKVFGEGRITMRKSAAKPKPAASGSPWYGADRVLYLG 55

Query: 266 PLSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA 445
           PLSG+PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLA
Sbjct: 56  PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLA 115

Query: 446 RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGG 625
           RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYR+AGG
Sbjct: 116 RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGG 175

Query: 626 PLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 805
           PLGE+VDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL
Sbjct: 176 PLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 235

Query: 806 ENLADHLADPVNNNAWAFATNFVPGK 883
           ENLADHLADPVNNNAWA+ATNFVPGK
Sbjct: 236 ENLADHLADPVNNNAWAYATNFVPGK 261
  9637.m01516|protein  chlorophyll a/b-binding protein I precursor -
           rice
           Length = 265
           
 Score =  491 bits (1251), Expect = e-139
 Identities = 240/266 (90%), Positives = 249/266 (93%), Gaps = 1/266 (0%)
 Frame = +2

Query: 86  MATTAMALSSSSFAGKAVKDLPSSALFGEARVTMRKTAAKAKPVSSS-SPWYGSDRVLYL 262
           MA   MALSS   A  A     SSALFGEAR+TMRKTAAK KP +SS SPWYG+DRVLYL
Sbjct: 1   MAAATMALSSPVMARAAPST--SSALFGEARITMRKTAAKPKPAASSGSPWYGADRVLYL 58

Query: 263 GPLSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELL 442
           GPLSG+PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL
Sbjct: 59  GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL 118

Query: 443 ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAG 622
           ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYR+AG
Sbjct: 119 ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAG 178

Query: 623 GPLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 802
           GPLGE+VDPLYPGG+FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP
Sbjct: 179 GPLGEVVDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 238

Query: 803 LENLADHLADPVNNNAWAFATNFVPGK 883
           LENLADHLADPVNNNAWA+ATNFVPGK
Sbjct: 239 LENLADHLADPVNNNAWAYATNFVPGK 265
  9631.m03807|protein  chlorophyll a/b binding protein
           Length = 263
           
 Score =  411 bits (1044), Expect = e-114
 Identities = 202/266 (75%), Positives = 225/266 (83%), Gaps = 2/266 (0%)
 Frame = +2

Query: 86  MATTAMALSSSSFAGKAVKDLPSSALFGEA--RVTMRKTAAKAKPVSSSSPWYGSDRVLY 259
           MA +A+   ++SF G A +        G++  R+TMR+T   A      S WYG DR  Y
Sbjct: 1   MAASALH-QTTSFLGTAPRRDELVRRVGDSGGRITMRRTVKSAP----QSIWYGPDRPKY 55

Query: 260 LGPLSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL 439
           LGP S   PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+
Sbjct: 56  LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEI 115

Query: 440 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVA 619
           L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LVHAQSILAIWA QVVLMG VEGYRV 
Sbjct: 116 LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVG 175

Query: 620 GGPLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 799
           GGPLGE +D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKG
Sbjct: 176 GGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKG 235

Query: 800 PLENLADHLADPVNNNAWAFATNFVPGK 883
           P+ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct: 236 PIENLFDHVADPVANNAWAYATNFVPGK 263
  9635.m03724|protein  chlorophyll a-b binding protein of lhcii type
           iii, chloroplastprecursor (cab)
           Length = 266
           
 Score =  344 bits (872), Expect = 3e-94
 Identities = 182/265 (68%), Positives = 198/265 (74%), Gaps = 5/265 (1%)
 Frame = +2

Query: 86  MATTAMALSSSSFAGKAV---KDLPSSALFGEARVTMRKTAAKAKPVSSSSPWYGSDRVL 256
           MA+T MA +S   A K        PS+A   +        AA  +   S   WYG DRV 
Sbjct: 1   MASTIMAPTSRVLAAKTPFLGHPRPSNAPVRDIAA-----AATGRITMSKELWYGPDRVK 55

Query: 257 YLGPLSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPE 436
           YLGP S   PSYL GEFPGDYGWDTAGLSADPE FA+NR LEVIH RWAMLGALGC+ PE
Sbjct: 56  YLGPFSAQTPSYLRGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCITPE 115

Query: 437 LLAR-NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYR 613
           +L +   V F E VWFKAG+QIFS+GGLDYLGNP+LVHAQSILA+   QVVLMG VEGYR
Sbjct: 116 VLEKWVRVDFKEPVWFKAGAQIFSDGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGYR 175

Query: 614 VAGGPLGEIVDPLYPGGS-FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVT 790
           + G P     + LYPGG  FDPLGLADDP  FAELKVKEIKNGRLAMFSMFGFFVQAIVT
Sbjct: 176 INGLPGVGDGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVT 235

Query: 791 GKGPLENLADHLADPVNNNAWAFATNFVPG 880
           GKGPLENL DHLADPV NNAW +AT F PG
Sbjct: 236 GKGPLENLLDHLADPVANNAWVYATKFTPG 265
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84180920 Number of Sequences: 59712 Number of extensions: 2787518 Number of successful extensions: 37641 Number of sequences better than 1.0e-10: 34 Number of HSP's better than 0.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 37487 Number of HSP's gapped (non-prelim): 46 length of query: 409 length of database: 26,991,925 effective HSP length: 51 effective length of query: 357 effective length of database: 23,946,613 effective search space: 8548940841 effective search space used: 8548940841 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG859   Members:2104           3pri:Y   9e-99       
BAB19812.1       ribulose-1,5-bisphosphate carboxylase/oxygenase small
subunit [Triticum aestivum]
         (1211 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9640.m01919|protein  Ribulose bisphosphate carboxylase, sm...   324  1e-88
 9640.m01925|protein  Ribulose bisphosphate carboxylase, sm...   320  4e-87
 9640.m01915|protein  Ribulose bisphosphate carboxylase, sm...   319  5e-87
 9640.m01725|protein  Ribulose bisphosphate carboxylase, sm...   317  2e-86
 9640.m01916|protein  Ribulose bisphosphate carboxylase, sm...   241  2e-63
 9640.m01926|protein  Ribulose bisphosphate carboxylase, sm...   239  9e-63
 9640.m01917|protein  Ribulose bisphosphate carboxylase, sm...   190  5e-48
 9630.m00509|protein  Ribulose bisphosphate carboxylase, sm...   177  3e-44

  9640.m01919|protein  Ribulose bisphosphate carboxylase, small
           subunit, putative
           Length = 175
           
 Score =  324 bits (823), Expect = 1e-88
 Identities = 150/173 (86%), Positives = 163/173 (93%)
 Frame = +2

Query: 197 MAPTVMASSATSVAPFQGLKSTAGLPVSRRSNGASLGSVSNGGRIRCMQVWPIEGIKKFE 376
           MAPTVMASSATSVAPFQGLKSTAGLPVSRRSN A LGSVSNGGRI CMQVWPIEGIKKFE
Sbjct: 1   MAPTVMASSATSVAPFQGLKSTAGLPVSRRSNSAGLGSVSNGGRISCMQVWPIEGIKKFE 60

Query: 377 TLSYLPPLSTEALLKQVDYLIRSKWVPCLEFSKVGFIFREHNASPGYYDGRYWTMWKLPM 556
           TLSYLPPL+ E LLKQ++YL+RSKWVPCLEFSKVGF++RE++ SPGYYDGRYWTMWKLPM
Sbjct: 61  TLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM 120

Query: 557 FGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 715
           FGCTDATQVL E+EE KK YPDA+VRIIGFDN+RQVQ +SFIA+KPPGCEESG
Sbjct: 121 FGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
  9640.m01925|protein  Ribulose bisphosphate carboxylase, small
           subunit, putative
           Length = 175
           
 Score =  320 bits (811), Expect = 4e-87
 Identities = 146/173 (84%), Positives = 164/173 (94%)
 Frame = +2

Query: 197 MAPTVMASSATSVAPFQGLKSTAGLPVSRRSNGASLGSVSNGGRIRCMQVWPIEGIKKFE 376
           MAP+VMASSATSVAPFQGLKSTAGLPV+RRS+ +S G+VSNGGRIRCMQVWPIEGIKKFE
Sbjct: 1   MAPSVMASSATSVAPFQGLKSTAGLPVNRRSSSSSFGNVSNGGRIRCMQVWPIEGIKKFE 60

Query: 377 TLSYLPPLSTEALLKQVDYLIRSKWVPCLEFSKVGFIFREHNASPGYYDGRYWTMWKLPM 556
           TLSYLPPL+ E LLKQ++YL+RSKWVPCLEFSKVGF++RE++ SPGYYDGRYWTMWKLPM
Sbjct: 61  TLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM 120

Query: 557 FGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 715
           FGCTDATQVL E+EE KK YPDA+VRIIGFDN+RQVQ +SFIA+KPPGCEESG
Sbjct: 121 FGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
  9640.m01915|protein  Ribulose bisphosphate carboxylase, small
           subunit
           Length = 175
           
 Score =  319 bits (810), Expect = 5e-87
 Identities = 146/173 (84%), Positives = 162/173 (93%)
 Frame = +2

Query: 197 MAPTVMASSATSVAPFQGLKSTAGLPVSRRSNGASLGSVSNGGRIRCMQVWPIEGIKKFE 376
           MAPTVMASSATSVAPFQGLKSTAGLPVSRRS  +  G+VSNGGRI+CMQVWPIEGIKKFE
Sbjct: 1   MAPTVMASSATSVAPFQGLKSTAGLPVSRRSTNSGFGNVSNGGRIKCMQVWPIEGIKKFE 60

Query: 377 TLSYLPPLSTEALLKQVDYLIRSKWVPCLEFSKVGFIFREHNASPGYYDGRYWTMWKLPM 556
           TLSYLPPL+ E LLKQ++YL+RSKWVPCLEFSKVGF++RE++ SPGYYDGRYWTMWKLPM
Sbjct: 61  TLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM 120

Query: 557 FGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 715
           FGCTDATQVL E+EE KK YPDA+VRIIGFDN+RQVQ +SFIA+KPPGCEESG
Sbjct: 121 FGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
  9640.m01725|protein  Ribulose bisphosphate carboxylase, small
           subunit, putative
           Length = 175
           
 Score =  317 bits (805), Expect = 2e-86
 Identities = 144/173 (83%), Positives = 163/173 (93%)
 Frame = +2

Query: 197 MAPTVMASSATSVAPFQGLKSTAGLPVSRRSNGASLGSVSNGGRIRCMQVWPIEGIKKFE 376
           MAP+VMASSAT+VAPFQGLKSTAG+PV+RRS  +S G+VSNGGRIRCMQVWPIEGIKKFE
Sbjct: 1   MAPSVMASSATTVAPFQGLKSTAGMPVARRSGNSSFGNVSNGGRIRCMQVWPIEGIKKFE 60

Query: 377 TLSYLPPLSTEALLKQVDYLIRSKWVPCLEFSKVGFIFREHNASPGYYDGRYWTMWKLPM 556
           TLSYLPPL+ E LLKQ++YL+RSKWVPCLEFSKVGF++RE++ SPGYYDGRYWTMWKLPM
Sbjct: 61  TLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM 120

Query: 557 FGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 715
           FGCTDATQVL E+EE KK YPDA+VRIIGFDN+RQVQ +SFIA+KPPGCEESG
Sbjct: 121 FGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
  9640.m01916|protein  Ribulose bisphosphate carboxylase, small
           subunit
           Length = 128
           
 Score =  241 bits (608), Expect = 2e-63
 Identities = 106/126 (84%), Positives = 119/126 (94%)
 Frame = +2

Query: 338 MQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPCLEFSKVGFIFREHNASPGY 517
           MQVWPIEGIKKFETLSYLPPL+ E LLKQ++YL+RSKWVPCLEFSKVGF++RE++ SPGY
Sbjct: 1   MQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGY 60

Query: 518 YDGRYWTMWKLPMFGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 697
           YDGRYWTMWKLPMFGCTDATQVL E+EE KK YPDA+VRIIGFDN+RQVQ +SFIA+KPP
Sbjct: 61  YDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPP 120

Query: 698 GCEESG 715
           GCEESG
Sbjct: 121 GCEESG 126
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74667107 Number of Sequences: 59712 Number of extensions: 2184013 Number of successful extensions: 15429 Number of sequences better than 1.0e-10: 16 Number of HSP's better than 0.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 15420 Number of HSP's gapped (non-prelim): 9 length of query: 403 length of database: 26,991,925 effective HSP length: 51 effective length of query: 352 effective length of database: 23,946,613 effective search space: 8429207776 effective search space used: 8429207776 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG867   Members:15             3pri:Y   7e-81       
AAO38473.1       putative RNA helicase, 5'-partial [Oryza sativa
(japonica cultivar-group)]
         (1983 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9631.m05073|protein  DEAD/DEAH box helicase, putative           593  e-169
 9640.m02859|protein  Similar to RNA helicase RH28 [importe...   180  6e-45
 9630.m04110|protein  DEAD/DEAH box helicase, putative           157  5e-38
 9631.m01932|protein  expressed protein                          157  6e-38
 9632.m04329|protein  DEAD/DEAH box helicase, putative           155  2e-37
 9632.m04328|protein  DEAD/DEAH box helicase, putative           155  2e-37
 9635.m04413|protein  DEAD/DEAH box helicase, putative           152  2e-36
 9638.m03197|protein  putative RNA helicase                      149  1e-35
 9631.m04891|protein  putative snRNP protein                     149  2e-35
 9631.m04890|protein  putative snRNP protein                     149  2e-35
 9636.m03206|protein  DEAD/DEAH box helicase, putative           142  2e-33
 9635.m04558|protein  DEAD/DEAH box helicase, putative           141  3e-33
 9629.m04143|protein  DEAD/DEAH box helicase, putative           139  2e-32
 9639.m03514|protein  Similar to AY088091 ATP-dependent RNA...   137  6e-32
 9634.m04745|protein  eukaryotic initiation factor 4a (eif4...   135  3e-31
 9630.m00452|protein  translational initiation factor eIF-4A     134  4e-31
 9629.m00708|protein  DEAD/DEAH box helicase, putative           134  5e-31
 9629.m03481|protein  Similar to RNA helicase, DRH1              133  9e-31
 9635.m04682|protein  DEAD/DEAH box helicase, putative           132  3e-30
 9635.m00438|protein  DEAD/DEAH box helicase, putative           131  6e-30

  9631.m05073|protein  DEAD/DEAH box helicase, putative
            Length = 646
            
 Score =  593 bits (1513), Expect = e-169
 Identities = 338/574 (58%), Positives = 397/574 (68%), Gaps = 20/574 (3%)
 Frame = +2

Query: 17   GGVKEEGKEAAAAA-----EEEEREVTFDELGLDEQLKRALRKKGLTKTTPIQREAIPLI 181
            G   EEG +AAA       EEEEREV+FDELGLDEQLKRALRKKGL K TPIQREAI   
Sbjct: 58   GAEGEEGPDAAARGGEEGKEEEEREVSFDELGLDEQLKRALRKKGLDKATPIQREAI--- 114

Query: 182  LEGKDVVAKAKTGSGKTFAYLLPLLQELLKLCKEGRIRKSASNALILVPTRELCQQVYNE 361
                                  PL+ E   +  + +     + A +L    EL       
Sbjct: 115  ----------------------PLILEGKDVVAKAKTGSGKTFAYLLPMLHEL------- 145

Query: 362  ASSLLELCTSKLKIVQVTASMSDKDIKLALSG-----PPNILVTTPACVAACISKGIVQG 526
                                     +KL+  G      PN+ +  P              
Sbjct: 146  -------------------------LKLSAEGRIRKSAPNVFILVPT------------- 167

Query: 527  SSIKESLSMMILDEADLLLSYRCEDDLKALVPHIPRSCQSILMSATSSPDIDKLTKLLLH 706
                  L   + +EA  LL + C   LK +  +   S + I ++ +  P+I   T   + 
Sbjct: 168  ----RELCQQVHNEASSLLEF-CTSKLKVVQVNASMSDKDIKVALSGPPNILVTTPACVA 222

Query: 707  NPFVLTLTEVGHAKDDVVPKNVQQFWISCSAKDKMLYILSLLKLELIQKKVLIFVNSIDN 886
            +     +      K+ +    + +  ISC AKDKMLYIL LLKLELIQKKVLIFVNSID+
Sbjct: 223  SCISKGIIRGSSIKESLSMMILDE--ISCDAKDKMLYILVLLKLELIQKKVLIFVNSIDS 280

Query: 887  AFRLRLFLEKFAIRSAVLNAELPQNSRLHIIEAFNARLFDYLIATDDNKTKDAKQTNKES 1066
            AF+LRLFLEKF IRS+VLNAELPQNSRLHII+AFNARLFDYLIATDDNK+K+ +Q NK +
Sbjct: 281  AFKLRLFLEKFGIRSSVLNAELPQNSRLHIIQAFNARLFDYLIATDDNKSKEERQANKGN 340

Query: 1067 KKDSKASRKHLQQTLDAEFGVVRGIDFKNVFT----------VVNFDMPPNPAGYIHRIG 1216
            KKDS+ SRK LQQTLDAEFGVVRGIDFKNVFT          VVN+DMPP+PAGY+HR+G
Sbjct: 341  KKDSRVSRKQLQQTLDAEFGVVRGIDFKNVFTFPFDLLFLKQVVNYDMPPDPAGYVHRVG 400

Query: 1217 RTGRANKTGASISLVSPEEENVFEEIEHMLQDVEKKDTNCILPFPLLTKNAVESLRYRAQ 1396
            RTGRANKTGASISLVSP+E  +FE+IE+ML+DVE +DT+CI PFPLLTKNAVESLRYRAQ
Sbjct: 401  RTGRANKTGASISLVSPKENGIFEDIENMLKDVENRDTSCISPFPLLTKNAVESLRYRAQ 460

Query: 1397 DVARSVTSRDIQEARRQDVKNEILNSEKLKAHFEENPTDLDLLKHDKLLTNKSIPAHLRD 1576
            DVARSVT+RDI+EARRQD+KNEILNSEKLKAHF+ENP DLDLLKHDKLL+NK IPAHLRD
Sbjct: 461  DVARSVTTRDIKEARRQDIKNEILNSEKLKAHFDENPRDLDLLKHDKLLSNKEIPAHLRD 520

Query: 1577 VPEYLIDPTTKEASNAVKLSRAAMGLDNPGRKKRMGFRSGSGKSSDPLRTFSAE 1738
            VPEYLIDPTTKEASN VKLSRAAM +D P R+KRMGF+ GSG+SSDPL+TFSAE
Sbjct: 521  VPEYLIDPTTKEASNVVKLSRAAMDIDKPRRRKRMGFKGGSGRSSDPLKTFSAE 574
  9640.m02859|protein  Similar to RNA helicase RH28 [imported] -
            Arabidopsis thaliana
            Length = 802
            
 Score =  180 bits (453), Expect = 6e-45
 Identities = 169/595 (28%), Positives = 274/595 (45%), Gaps = 26/595 (4%)
 Frame = +2

Query: 26   KEEGKEAAAAAEEEEREVT---------------------FDELGLDEQLKRALRKKGLT 142
            KEEG E AA  EEE  + +                     F EL L   L RA    G  
Sbjct: 156  KEEGDEEAAEEEEETDKKSGVVDPSKFFASSEGASFHANSFLELNLSRPLLRACEALGYQ 215

Query: 143  KTTPIQREAIPLILEGKDVVAKAKTGSGKTFAYLLPLLQELLKLCKEGRIRKSASNALIL 322
            K TPIQ   IPL L G+D+   A TGSGKT A+ LP+L+ LL   K    R  A   LIL
Sbjct: 216  KPTPIQAACIPLALTGRDICGSAITGSGKTAAFSLPVLERLLFRPK----RVPAIRVLIL 271

Query: 323  VPTRELCQQVYNEASSLLELCTSKLKIVQVTASMSDKDIKLALSGPPNILVTTPACVAAC 502
             PTREL  QV++    L +   + ++   +   +S K  ++AL   P+I+V TP  +   
Sbjct: 272  TPTRELAAQVHSMIEKLAQF--TDIRCCLIVGGLSTKVQEVALRSMPDIVVATPGRIIDH 329

Query: 503  ISKGIVQGSSIKESLSMMILDEADLLLSYRCEDDLKALVPHIPRSCQSILMSATSSPDID 682
            +   +  G    E L+++ILDEAD LL      +++ L+   PR  Q++L SAT + +I+
Sbjct: 330  LRNSLSVG---LEDLAILILDEADRLLELGFSAEIQELIRMCPRRRQTMLFSATMTEEIN 386

Query: 683  KLTKLLLHNPFVL----TLTEVGHAKDDVVPKNVQQFWISCSAKDKMLYILSLLKLELIQ 850
            +L  L L+ P  L    +L       ++VV        I  + +     +L  L L+  +
Sbjct: 387  ELVTLSLNKPVRLEADPSLKRPATLTEEVVR-------IRRAREANQEAVLLALCLKTFK 439

Query: 851  KKVLIFVNSIDNAFRLRLFLEKFAIRSAVLNAELPQNSRLHIIEAFNARLFDYLIATDDN 1030
             KV+IF  +  +A RL++      +++A L+  L Q  RL  +E F  +  D+LIATD  
Sbjct: 440  DKVIIFSGTKHSAHRLKIIFGLSGMKAAELHGNLTQAQRLEALELFKKQEVDFLIATD-- 497

Query: 1031 KTKDAKQTNKESKKDSKASRKHLQQTLDAEFGVVRGIDFKNVFTVVNFDMPPNPAGYIHR 1210
                                              RGID   V TV+NF  P +   Y+HR
Sbjct: 498  -------------------------------VAARGIDIVGVRTVINFSCPRDARTYLHR 526

Query: 1211 IGRTGRANKTGASISLVSPEEENVFEEIEHMLQDVEKKDTNCILPFPLLTKNAVESLRYR 1390
            +GRT RA + G +++ V+ ++ ++ + I         K     L   ++ +  V      
Sbjct: 527  VGRTARAGREGYAVTFVTDDDRSLLKAI--------AKKAGSQLKSRIVAEKPVAECAKL 578

Query: 1391 AQDVARSVTSRDIQEARRQDVKNEILNSEKLKAHFEENPTDLDLLKH-DKLLTNKSIPAH 1567
             +++   + S  IQE R +     IL   +++A   EN     ++ H D++ +       
Sbjct: 579  IEELEDQI-STIIQEEREE----RILRKAEMEATKAEN-----MIAHKDEIYSRPKRTWF 628

Query: 1568 LRDVPEYLIDPTTKEASNAVKLSRAAMGLDNPGRKKRMGFRSGSGKSSDPLRTFSAEGKS 1747
              +  + L+    KE+++  K +   +                S + ++ LR      K 
Sbjct: 629  ATEKEKKLLAKAAKESTSQGKSNSGVI----------------SAQQAEDLRL-----KE 667

Query: 1748 RRRRGKEREGDDRRKRRKKAE 1810
            ++RR +E+    +++RR +AE
Sbjct: 668  KKRREREKNLPRKKRRRLEAE 688
  9630.m04110|protein  DEAD/DEAH box helicase, putative
            Length = 508
            
 Score =  157 bits (394), Expect = 5e-38
 Identities = 115/408 (28%), Positives = 193/408 (47%)
 Frame = +2

Query: 83   FDELGLDEQLKRALRKKGLTKTTPIQREAIPLILEGKDVVAKAKTGSGKTFAYLLPLLQE 262
            F++  L  +L   + +KG  + +PIQ E+IP+ L G D++A+AK G+GKT A+ +P L++
Sbjct: 136  FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEK 195

Query: 263  LLKLCKEGRIRKSASNALILVPTRELCQQVYNEASSLLELCTSKLKIVQVTASMSDKDIK 442
            + +        K+A   +ILVPTREL  Q       L +    K++++  T   S KD  
Sbjct: 196  IDQ-------EKNAIQVVILVPTRELALQTSQVCKELGK--HLKIQVMVTTGGTSLKDDI 246

Query: 443  LALSGPPNILVTTPACVAACISKGIVQGSSIKESLSMMILDEADLLLSYRCEDDLKALVP 622
            + L  P ++LV TP  +     KGI     I +  SM+I+DEAD LLS   +  ++ L+ 
Sbjct: 247  IRLYQPVHLLVGTPGRILDLTKKGI----CILKDCSMLIMDEADKLLSPEFQPSVEQLIR 302

Query: 623  HIPRSCQSILMSATSSPDIDKLTKLLLHNPFVLTLTEVGHAKDDVVPKNVQQFWISCSAK 802
            ++P S Q ++ SAT    + +     L  P+V+ L       D++  K + QF+     +
Sbjct: 303  YLPASRQILMFSATFPVTVKEFKDKYLPKPYVINL------MDELTLKGITQFYAFVEER 356

Query: 803  DKMLYILSLLKLELIQKKVLIFVNSIDNAFRLRLFLEKFAIRSAVLNAELPQNSRLHIIE 982
             K ++ L+ L  +L   + +IF NS++    L   + +       ++A++ Q+ R  +  
Sbjct: 357  QK-VHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFH 415

Query: 983  AFNARLFDYLIATDDNKTKDAKQTNKESKKDSKASRKHLQQTLDAEFGVVRGIDFKNVFT 1162
             F       L+ TD                                    RGID + V  
Sbjct: 416  DFRNGACRNLVCTD---------------------------------LFTRGIDIQAVNV 442

Query: 1163 VVNFDMPPNPAGYIHRIGRTGRANKTGASISLVSPEEENVFEEIEHML 1306
            V+NFD P     Y+HR+GR+GR    G +++L++ E+      IE  L
Sbjct: 443  VINFDFPKTAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQEL 490
  9631.m01932|protein  expressed protein
            Length = 770
            
 Score =  157 bits (393), Expect = 6e-38
 Identities = 113/409 (27%), Positives = 196/409 (47%), Gaps = 1/409 (0%)
 Frame = +2

Query: 80   TFDELGLDEQLKRALRKKGLTKTTPIQREAIPLILEGKDVVAKAKTGSGKTFAYLLPLLQ 259
            +F + G   QL  A+ K+G  K T IQ +A+P++L G+D++  AKTGSGKT A++LP++ 
Sbjct: 220  SFADCGFPVQLMNAIAKQGYEKPTTIQCQALPIVLSGRDIIGIAKTGSGKTAAFVLPMIV 279

Query: 260  ELLKLCKEGRIRKSASNALILVPTRELCQQVYNEASSLLELCTSKLKIVQVTASMSDKDI 439
             ++   +    ++     ++  PTREL  Q+Y EA    +     L++  V   +S  D 
Sbjct: 280  HIMD--QPELEKEEGPIGVVCAPTRELAHQIYLEAKKFAK--PYNLRVAAVYGGVSKFDQ 335

Query: 440  KLALSGPPNILVTTPACVAACISKGIVQGSSIKESLSMMILDEADLLLSYRCEDDLKALV 619
               L     I++ TP  +   +    ++        + ++LDEAD +     E  ++++V
Sbjct: 336  FKELKAGCEIVIATPGRLIDLLKMKALK----MFRATYLVLDEADRMFDLGFEPQIRSIV 391

Query: 620  PHIPRSCQSILMSATSSPDIDKLTKLLLHNPFVLTLTEVGHAKDDVVPKNVQQFWISCSA 799
              I    Q++L SAT    +++L + +L +P  +T+ +VG A +D+     Q   +  S 
Sbjct: 392  GQIRPDRQTLLFSATMPYKVERLAREILTDPIRVTVGQVGSANEDI----KQVVNVLPSD 447

Query: 800  KDKMLYILSLLKLELIQKKVLIFVNSIDNAFRLRLFLEKFAIRSAVLNAELPQNSRLHII 979
             +KM ++L  L   +    VL+F         +   L +   R A L+ +  Q SR+  +
Sbjct: 448  AEKMPWLLEKLPGMIDDGDVLVFAAKKARVDEIESQLNQRGFRIAALHGDKDQASRMETL 507

Query: 980  EAFNARLFDYLIATDDNKTKDAKQTNKESKKDSKASRKHLQQTLDAEFGVVRGIDFKNVF 1159
            + F + ++  L+ATD                                    RG+D K++ 
Sbjct: 508  QKFKSGVYHVLVATD---------------------------------VAARGLDIKSIK 534

Query: 1160 TVVNFDMPPNPAGYIHRIGRTGRA-NKTGASISLVSPEEENVFEEIEHML 1306
            TVVNFD+      +IHRIGRTGRA +K G + +L++ +E     E+ H L
Sbjct: 535  TVVNFDIAKEMDMHIHRIGRTGRAGDKDGTAYTLITQKEVRFAGELVHCL 584
  9632.m04329|protein  DEAD/DEAH box helicase, putative
            Length = 498
            
 Score =  155 bits (388), Expect = 2e-37
 Identities = 111/408 (27%), Positives = 195/408 (47%)
 Frame = +2

Query: 83   FDELGLDEQLKRALRKKGLTKTTPIQREAIPLILEGKDVVAKAKTGSGKTFAYLLPLLQE 262
            F++  L  +L   + +KG  + +PIQ E+IP+ L G D++A+AK G+GKT A+ +P L++
Sbjct: 126  FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEK 185

Query: 263  LLKLCKEGRIRKSASNALILVPTRELCQQVYNEASSLLELCTSKLKIVQVTASMSDKDIK 442
            + +        K+A   +ILVPTREL  Q       L +    K++++  T   S KD  
Sbjct: 186  IDQ-------DKNAIQVVILVPTRELALQTSQVCKELGK--HLKIQVMVTTGGTSLKDDI 236

Query: 443  LALSGPPNILVTTPACVAACISKGIVQGSSIKESLSMMILDEADLLLSYRCEDDLKALVP 622
            + L  P ++LV TP  +     KG+     + ++ SM+++DEAD LLS   +  ++ L+ 
Sbjct: 237  VRLYQPVHLLVGTPGRILDLTKKGV----CVLKNCSMLVMDEADKLLSPEFQPSIQELIR 292

Query: 623  HIPRSCQSILMSATSSPDIDKLTKLLLHNPFVLTLTEVGHAKDDVVPKNVQQFWISCSAK 802
            ++P + Q ++ SAT    + +     L  P+V+ L       D++  K + QF+     +
Sbjct: 293  YLPSNRQILMFSATFPVTVKEFKDKYLPKPYVINL------MDELTLKGITQFYAFVEER 346

Query: 803  DKMLYILSLLKLELIQKKVLIFVNSIDNAFRLRLFLEKFAIRSAVLNAELPQNSRLHIIE 982
             K ++ L+ L  +L   + +IF NS++    L   + +       ++A++ Q+ R  +  
Sbjct: 347  QK-VHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFH 405

Query: 983  AFNARLFDYLIATDDNKTKDAKQTNKESKKDSKASRKHLQQTLDAEFGVVRGIDFKNVFT 1162
             F       L+ TD                                    RGID + V  
Sbjct: 406  DFRNGACRNLVCTD---------------------------------LFTRGIDIQAVNV 432

Query: 1163 VVNFDMPPNPAGYIHRIGRTGRANKTGASISLVSPEEENVFEEIEHML 1306
            V+NFD P +   Y+HR+GR+GR    G +++L++ E+      IE  L
Sbjct: 433  VINFDFPKSAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQEL 480
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 111527076 Number of Sequences: 59712 Number of extensions: 3161080 Number of successful extensions: 95957 Number of sequences better than 1.0e-10: 82 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 60 Number of HSP's that attempted gapping in prelim test: 95411 Number of HSP's gapped (non-prelim): 318 length of query: 661 length of database: 26,991,925 effective HSP length: 53 effective length of query: 607 effective length of database: 23,827,189 effective search space: 14463103723 effective search space used: 14463103723 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 161 (67.1 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG871   Members:20             3pri:Y   8e-39       
T04407           probable phospholipid transfer protein precursor -
barley gb|AAA86694.1| phospholipid transfer protein precurs
         (740 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9639.m02120|protein  phospholipid transfer protein homolog...   135  1e-31
 9639.m00145|protein  Protease inhibitor/seed storage/LTP f...   134  2e-31
 9640.m00134|protein  phospholipid transfer protein homolog...   133  4e-31
 9639.m00143|protein  nonspecific lipid-transfer protein 2 ...   132  6e-31
 9640.m00133|protein  nonspecific lipid-transfer protein 2 ...   131  1e-30
 9639.m00146|protein  lipid-transfer protein - maize             121  1e-27
 9640.m00135|protein  lipid-transfer protein - maize             119  5e-27
 9640.m00136|protein  lipid-transfer protein - maize             117  2e-26
 9640.m00132|protein  lipid transfer protein                     116  3e-26
 9639.m00141|protein  lipid transfer protein                     116  3e-26
 9639.m00148|protein  lipid-transfer protein - maize             115  7e-26
 9640.m00131|protein  Similar to nonspecific lipid-transfer...   111  1e-24
 9639.m00139|protein  Similar to nonspecific lipid-transfer...   108  2e-23
 9629.m05973|protein  Protease inhibitor/seed storage/LTP f...   106  5e-23
 9629.m05972|protein  Protease inhibitor/seed storage/LTP f...   104  1e-22
 9629.m05974|protein  Protease inhibitor/seed storage/LTP f...   104  1e-22
 9633.m03731|protein  Protease inhibitor/seed storage/LTP f...   102  5e-22
 9629.m01162|protein  Protease inhibitor/seed storage/LTP f...    88  2e-17
 9634.m03292|protein  Protease inhibitor/seed storage/LTP f...    87  3e-17
 9636.m00287|protein  nonspecific lipid-transfer protein a ...    87  4e-17

  9639.m02120|protein  phospholipid transfer protein homolog - rice
           Length = 117
           
 Score =  135 bits (336), Expect = 1e-31
 Identities = 68/110 (61%), Positives = 87/110 (78%), Gaps = 5/110 (4%)
 Frame = +2

Query: 86  AATQLVLVAMVAAMLLVAADAA--ISCGQVSSALRPCISYASGNGGILPPACCSGVKRLA 259
           A  QLVLVA+VAA+LL A  AA  I+CGQV+SA+ PC++YA G G     ACC+GV+ L 
Sbjct: 2   ARAQLVLVAVVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGGAGPSAACCNGVRSLK 61

Query: 260 GAAQSTADKQAVCKCIKSAA---AGLNAGKAAGIPSKCGVSVPYSISTSVDCSKI 415
            AA++TAD++  C C+K+AA    GLNAG AA IPSKCGVSVPY+IS S+DCS++
Sbjct: 62  SAARTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRV 116
  9639.m00145|protein  Protease inhibitor/seed storage/LTP family,
           putative
           Length = 116
           
 Score =  134 bits (333), Expect = 2e-31
 Identities = 70/110 (63%), Positives = 86/110 (77%), Gaps = 5/110 (4%)
 Frame = +2

Query: 86  AATQLVLVAMVAAMLLVAADAA--ISCGQVSSALRPCISYASGNGGILPPACCSGVKRLA 259
           A  QLVLVA+VAA+LL A  AA  I+CGQV+SA+ PC++YA G  G    ACCSGV+ L 
Sbjct: 2   ARAQLVLVAVVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGP-SAACCSGVRSLK 60

Query: 260 GAAQSTADKQAVCKCIKSAAAG---LNAGKAAGIPSKCGVSVPYSISTSVDCSKI 415
            AA STAD++  C C+K+AA G   LNAG AA IPSKCGVSVPY+IS S+DCS++
Sbjct: 61  AAASSTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRV 115
  9640.m00134|protein  phospholipid transfer protein homolog - rice
           Length = 116
           
 Score =  133 bits (331), Expect = 4e-31
 Identities = 69/110 (62%), Positives = 86/110 (77%), Gaps = 5/110 (4%)
 Frame = +2

Query: 86  AATQLVLVAMVAAMLLVAADAA--ISCGQVSSALRPCISYASGNGGILPPACCSGVKRLA 259
           A  QLVLVA+VAA+LL A  AA  I+CGQV+SA+ PC++YA G  G    ACCSGV+ L 
Sbjct: 2   ARAQLVLVALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGP-SAACCSGVRSLK 60

Query: 260 GAAQSTADKQAVCKCIKSAAAG---LNAGKAAGIPSKCGVSVPYSISTSVDCSKI 415
            AA +TAD++  C C+K+AA G   LNAG AA IPSKCGVSVPY+IS S+DCS++
Sbjct: 61  AAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRV 115
  9639.m00143|protein  nonspecific lipid-transfer protein 2 precursor
           (ltp 2).
           Length = 118
           
 Score =  132 bits (329), Expect = 6e-31
 Identities = 69/111 (62%), Positives = 86/111 (77%), Gaps = 7/111 (6%)
 Frame = +2

Query: 86  AATQLVLVAMVAAMLLVAAD----AAISCGQVSSALRPCISYASGNGGILPPACCSGVKR 253
           A  QLVLVA+VAA LL+A      AAISCGQV+SA+ PC+SYA G  G    ACCSGV+ 
Sbjct: 2   ARAQLVLVALVAAALLLAGPHTTMAAISCGQVNSAVSPCLSYARGGSGP-SAACCSGVRS 60

Query: 254 LAGAAQSTADKQAVCKCIKSAA---AGLNAGKAAGIPSKCGVSVPYSISTSVDCSKIH 418
           L  AA +TAD++  C C+K+ A   +GLNAG AA IPSKCGVS+PY+IS S+DCS ++
Sbjct: 61  LNSAASTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN 118
  9640.m00133|protein  nonspecific lipid-transfer protein 2 precursor
           (ltp 2).
           Length = 117
           
 Score =  131 bits (326), Expect = 1e-30
 Identities = 68/111 (61%), Positives = 85/111 (76%), Gaps = 6/111 (5%)
 Frame = +2

Query: 86  AATQLVLVAMVAAMLLVAAD---AAISCGQVSSALRPCISYASGNGGILPPACCSGVKRL 256
           A  QLVLVA+VAA+LL       AAISCGQV+SA+ PC+SYA G  G    ACCSGV+ L
Sbjct: 2   ARAQLVLVALVAALLLAGPHTTMAAISCGQVNSAVSPCLSYARGGSGP-SAACCSGVRSL 60

Query: 257 AGAAQSTADKQAVCKCIKSAA---AGLNAGKAAGIPSKCGVSVPYSISTSVDCSKIH 418
             AA +TAD++  C C+K+ A   +GLNAG AA IPSKCGVS+PY+IS S+DCS ++
Sbjct: 61  NSAATTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN 117
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43759486 Number of Sequences: 59712 Number of extensions: 1195617 Number of successful extensions: 11304 Number of sequences better than 1.0e-10: 41 Number of HSP's better than 0.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 15 Number of HSP's that attempted gapping in prelim test: 11260 Number of HSP's gapped (non-prelim): 21 length of query: 246 length of database: 26,991,925 effective HSP length: 50 effective length of query: 196 effective length of database: 24,006,325 effective search space: 4705239700 effective search space used: 4705239700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 157 (65.6 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG873   Members:52             3pri:Y   1e-115      
AAB99745.1       HSP70 [Triticum aestivum]
         (1393 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9629.m06146|protein  dnaK protein                               745  0.0
 9633.m03578|protein  dnaK protein                               738  0.0
 9633.m03577|protein  dnaK protein                               738  0.0
 9639.m04467|protein  dnaK-type molecular chaperone hsp70 -...   725  0.0
 9639.m04468|protein  dnaK-type molecular chaperone hsp70 -...   725  0.0
 9631.m05972|protein  heat shock protein cognate 70              724  0.0
 9631.m01647|protein  dnaK protein                               722  0.0
 9631.m01656|protein  heat shock cognate 70 kda protein          695  0.0
 9630.m00144|protein  dnaK-type molecular chaperone BiP - rice   473  e-133
 9631.m04907|protein  putative luminal binding protein           446  e-125
 9633.m03294|protein  luminal binding protein 5 precursor (...   438  e-122
 9636.m04621|protein  BiP-isoform D                              431  e-120
 9633.m02768|protein  luminal binding protein 4 precursor (...   418  e-116
 9631.m01650|protein  dnaK protein                               408  e-113
 9639.m00795|protein  Similar to dnaK-type molecular chaper...   372  e-103
 9639.m00796|protein  Similar to hsp70                           331  2e-90
 9639.m00793|protein  dnaK protein, putative                     323  6e-88
 9630.m05282|protein  dnaK protein                               305  2e-82
 9631.m00134|protein  dnaK protein                               301  2e-81
 9640.m01362|protein  heat shock protein, 70K, chloroplast ...   295  1e-79

  9629.m06146|protein  dnaK protein
            Length = 648
            
 Score =  745 bits (1902), Expect = 0.0
 Identities = 366/389 (94%), Positives = 378/389 (97%)
 Frame = +1

Query: 1    GNPRSLRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFYTTITRARFEELNMDLFRKCM 180
            GNPR+LRRLRTACERAKRTLSSTAQTTIEIDSLYEG+DFY+TITRARFEELNMDLFRKCM
Sbjct: 260  GNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCM 319

Query: 181  EPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAA 360
            EPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAA
Sbjct: 320  EPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAA 379

Query: 361  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTYSDN 540
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT LIPRNTTIPTKKEQVFSTYSDN
Sbjct: 380  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN 439

Query: 541  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT 720
            QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct: 440  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT 499

Query: 721  TGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVDAKNALENYAYNMRNTVK 900
            TGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVDAKNALENYAYNMRNT+K
Sbjct: 500  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK 559

Query: 901  DEKIASKLGADDKKKVEDAVEGTISWLDGNQLAEAEEFEDKMKELEGICNPIIAKMYQGA 1080
            D+KIASKL ADDKKK+EDA++G I+WLD NQLAEA+EFEDKMKELE ICNPIIAKMYQGA
Sbjct: 560  DDKIASKLSADDKKKIEDAIDGAINWLDSNQLAEADEFEDKMKELESICNPIIAKMYQGA 619

Query: 1081 APDMGGGMGMDEDMPAGGGGAGPKIEEVD 1167
              DMGG  GMDED PAGG GAGPKIEEVD
Sbjct: 620  GADMGGAAGMDEDAPAGGSGAGPKIEEVD 648
  9633.m03578|protein  dnaK protein
            Length = 646
            
 Score =  738 bits (1885), Expect = 0.0
 Identities = 366/389 (94%), Positives = 376/389 (96%)
 Frame = +1

Query: 1    GNPRSLRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFYTTITRARFEELNMDLFRKCM 180
            GNPR+LRRLRTACERAKRTLSSTAQTTIEIDSLYEG+DFYTTITRARFEELNMDLFRKCM
Sbjct: 260  GNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCM 319

Query: 181  EPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAA 360
            EPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAA
Sbjct: 320  EPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAA 379

Query: 361  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTYSDN 540
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT LIPRNTTIPTKKEQVFSTYSDN
Sbjct: 380  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN 439

Query: 541  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT 720
            QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct: 440  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT 499

Query: 721  TGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVDAKNALENYAYNMRNTVK 900
            TGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVDAKNALENYAYNMRNT+K
Sbjct: 500  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK 559

Query: 901  DEKIASKLGADDKKKVEDAVEGTISWLDGNQLAEAEEFEDKMKELEGICNPIIAKMYQGA 1080
            DEKIASKL ADDKK++EDA++G ISWLD NQLAEA+EFEDKMKELEGICNPIIAKMYQG 
Sbjct: 560  DEKIASKLAADDKKRIEDAIDGAISWLDTNQLAEADEFEDKMKELEGICNPIIAKMYQGP 619

Query: 1081 APDMGGGMGMDEDMPAGGGGAGPKIEEVD 1167
              DM G  GMDED PAGG GAGPKIEEVD
Sbjct: 620  GADMAG--GMDEDAPAGGSGAGPKIEEVD 646
  9633.m03577|protein  dnaK protein
            Length = 558
            
 Score =  738 bits (1885), Expect = 0.0
 Identities = 366/389 (94%), Positives = 376/389 (96%)
 Frame = +1

Query: 1    GNPRSLRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFYTTITRARFEELNMDLFRKCM 180
            GNPR+LRRLRTACERAKRTLSSTAQTTIEIDSLYEG+DFYTTITRARFEELNMDLFRKCM
Sbjct: 172  GNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCM 231

Query: 181  EPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAA 360
            EPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAA
Sbjct: 232  EPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAA 291

Query: 361  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTYSDN 540
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT LIPRNTTIPTKKEQVFSTYSDN
Sbjct: 292  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN 351

Query: 541  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT 720
            QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDKT
Sbjct: 352  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKT 411

Query: 721  TGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVDAKNALENYAYNMRNTVK 900
            TGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVDAKNALENYAYNMRNT+K
Sbjct: 412  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIK 471

Query: 901  DEKIASKLGADDKKKVEDAVEGTISWLDGNQLAEAEEFEDKMKELEGICNPIIAKMYQGA 1080
            DEKIASKL ADDKK++EDA++G ISWLD NQLAEA+EFEDKMKELEGICNPIIAKMYQG 
Sbjct: 472  DEKIASKLAADDKKRIEDAIDGAISWLDTNQLAEADEFEDKMKELEGICNPIIAKMYQGP 531

Query: 1081 APDMGGGMGMDEDMPAGGGGAGPKIEEVD 1167
              DM G  GMDED PAGG GAGPKIEEVD
Sbjct: 532  GADMAG--GMDEDAPAGGSGAGPKIEEVD 558
  9639.m04467|protein  dnaK-type molecular chaperone hsp70 - rice
            (fragment)
            Length = 649
            
 Score =  725 bits (1852), Expect = 0.0
 Identities = 356/389 (91%), Positives = 374/389 (95%)
 Frame = +1

Query: 1    GNPRSLRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFYTTITRARFEELNMDLFRKCM 180
            GNPR+LRRLRTACERAKRTLSSTAQTTIEIDSLYEG+DFY+TITRARFEELNMDLFRKCM
Sbjct: 261  GNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCM 320

Query: 181  EPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAA 360
            EPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQDFFNGKELCK+INPDEAVAYGAA
Sbjct: 321  EPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQDFFNGKELCKNINPDEAVAYGAA 380

Query: 361  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTYSDN 540
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT LIPRNTTIPTKKEQVFSTYSDN
Sbjct: 381  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN 440

Query: 541  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT 720
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct: 441  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT 500

Query: 721  TGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVDAKNALENYAYNMRNTVK 900
            TGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKV++KNALENYAYNMRNT+K
Sbjct: 501  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK 560

Query: 901  DEKIASKLGADDKKKVEDAVEGTISWLDGNQLAEAEEFEDKMKELEGICNPIIAKMYQGA 1080
            DEKIASKL A DKKK+EDA++  I WLDGNQLAEA+EF+DKMKELEGICNPIIAKMYQGA
Sbjct: 561  DEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMYQGA 620

Query: 1081 APDMGGGMGMDEDMPAGGGGAGPKIEEVD 1167
              DM GGM  D+  PAGG GAGPKIEEVD
Sbjct: 621  GADMAGGMDEDDAPPAGGSGAGPKIEEVD 649
  9639.m04468|protein  dnaK-type molecular chaperone hsp70 - rice
            (fragment)
            Length = 602
            
 Score =  725 bits (1852), Expect = 0.0
 Identities = 356/389 (91%), Positives = 374/389 (95%)
 Frame = +1

Query: 1    GNPRSLRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFYTTITRARFEELNMDLFRKCM 180
            GNPR+LRRLRTACERAKRTLSSTAQTTIEIDSLYEG+DFY+TITRARFEELNMDLFRKCM
Sbjct: 214  GNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCM 273

Query: 181  EPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAA 360
            EPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQDFFNGKELCK+INPDEAVAYGAA
Sbjct: 274  EPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQDFFNGKELCKNINPDEAVAYGAA 333

Query: 361  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTYSDN 540
            VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMT LIPRNTTIPTKKEQVFSTYSDN
Sbjct: 334  VQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDN 393

Query: 541  QPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT 720
            QPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT
Sbjct: 394  QPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT 453

Query: 721  TGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVDAKNALENYAYNMRNTVK 900
            TGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKV++KNALENYAYNMRNT+K
Sbjct: 454  TGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTIK 513

Query: 901  DEKIASKLGADDKKKVEDAVEGTISWLDGNQLAEAEEFEDKMKELEGICNPIIAKMYQGA 1080
            DEKIASKL A DKKK+EDA++  I WLDGNQLAEA+EF+DKMKELEGICNPIIAKMYQGA
Sbjct: 514  DEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMYQGA 573

Query: 1081 APDMGGGMGMDEDMPAGGGGAGPKIEEVD 1167
              DM GGM  D+  PAGG GAGPKIEEVD
Sbjct: 574  GADMAGGMDEDDAPPAGGSGAGPKIEEVD 602
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 111664052 Number of Sequences: 59712 Number of extensions: 4434840 Number of successful extensions: 79289 Number of sequences better than 1.0e-10: 54 Number of HSP's better than 0.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 79005 Number of HSP's gapped (non-prelim): 124 length of query: 464 length of database: 26,991,925 effective HSP length: 52 effective length of query: 411 effective length of database: 23,886,901 effective search space: 9817516311 effective search space used: 9817516311 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG875   Members:8              3pri:Y   3e-66       
AAD39600.1       Similar to gb|U43629 integral membrane protein from
Beta vulgaris and is a member of the sugar transporter fam
         (1020 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9633.m04731|protein  Sugar transporter                          314  1e-85
 9633.m04617|protein  Sugar transporter                          308  9e-84
 9633.m04618|protein  major facilitator superfamily protein      273  3e-73
 9639.m03910|protein  Similar to sugar transporter-like pro...   185  8e-47
 9631.m02426|protein  BT000608 At5g18840/F17K4_90                175  9e-44
 9631.m02425|protein  Sugar transporter, putative                174  3e-43
 9635.m03923|protein  sugar transporter, putative                133  4e-31
 9632.m05689|protein  sugar transporter, putative                123  4e-28
 9629.m07289|protein  Sugar transporter                          122  8e-28
 9635.m03924|protein  sugar transporter, putative                120  3e-27
 9632.m03950|protein  Sugar transporter                          120  3e-27
 9631.m00914|protein  probable sugar transporter [imported]...   117  3e-26
 9632.m05690|protein  sugar transporter, putative                114  2e-25
 9632.m04300|protein  Sugar transporter                          113  7e-25
 9631.m00915|protein  sorbitol transporter                       112  9e-25
 9640.m03206|protein  sorbitol transporter                       112  9e-25
 9639.m03848|protein  AF482011 sorbitol transporter              111  2e-24
 9640.m03185|protein  sorbitol transporter                       111  3e-24
 9629.m00336|protein  hexose transporter                         110  4e-24
 9631.m01110|protein  Sugar transporter                          110  5e-24

  9633.m04731|protein  Sugar transporter
           Length = 436
           
 Score =  314 bits (797), Expect = 1e-85
 Identities = 152/223 (68%), Positives = 193/223 (86%)
 Frame = +3

Query: 9   QQRAAIRFQELNQKKFRMPLILGIGLLVLQQLSGINAILFYASSIFKAAGITNSDLATCG 188
           ++R  IRF ++ QK++ +PL++GIGLLVLQQLSG+N ILFYA+SIFKAAG+TNS+LAT G
Sbjct: 214 RRRTTIRFADIKQKRYSVPLMIGIGLLVLQQLSGVNGILFYAASIFKAAGLTNSNLATFG 273

Query: 189 LGGIQVLATLVTTWLLDRAGRRILLIISSAGMTLSLLAVAVVFFIKDTVSQDSHMYYILS 368
           LG +QV+AT VTTWL D+AGRR+LLIIS+ GMT++L+ V+V FF+KD ++  SH+Y ++S
Sbjct: 274 LGVVQVVATGVTTWLTDKAGRRLLLIISTTGMTITLVVVSVSFFVKDNITNGSHLYSVMS 333

Query: 369 MVSLLAIVAYVIAFSFGMGAIPWVIMSEILPVSIKSLAGSFATLANWLTSFGITMTANLL 548
           M+SL+ +VA+VI+FS G+GAIPW+IMSEILPV+IKSLAGS ATLANWLT++ ITMTA+L+
Sbjct: 334 MLSLVGLVAFVISFSLGLGAIPWIIMSEILPVNIKSLAGSVATLANWLTAWLITMTASLM 393

Query: 549 LSWSAGGTFVSYMLVSAFTLVFVVLWVPETKGRTLEEIQWSFR 677
           LSWS GGTF  Y  V A TLVFV LWVPETKGRTLEEI +SFR
Sbjct: 394 LSWSNGGTFAIYAAVCAGTLVFVCLWVPETKGRTLEEIAFSFR 436
  9633.m04617|protein  Sugar transporter
           Length = 476
           
 Score =  308 bits (781), Expect = 9e-84
 Identities = 157/221 (71%), Positives = 180/221 (81%)
 Frame = +3

Query: 12  QRAAIRFQELNQKKFRMPLILGIGLLVLQQLSGINAILFYASSIFKAAGITNSDLATCGL 191
           +R  +RF+ELNQKK+R PL++G GLLVLQ LSGIN ILFYAS IF+ AG TNSDLATC L
Sbjct: 276 KRTTVRFKELNQKKYRTPLLIGTGLLVLQNLSGINGILFYASRIFRDAGFTNSDLATCAL 335

Query: 192 GGIQVLATLVTTWLLDRAGRRILLIISSAGMTLSLLAVAVVFFIKDTVSQDSHMYYILSM 371
           G IQ                     IS+AGMTLSLLAV+VVFF++  +S DSH +YILSM
Sbjct: 336 GAIQ---------------------ISTAGMTLSLLAVSVVFFLEGNISHDSHSFYILSM 374

Query: 372 VSLLAIVAYVIAFSFGMGAIPWVIMSEILPVSIKSLAGSFATLANWLTSFGITMTANLLL 551
           +SL+A+VAY+I FSFGMGAIPWV+MSEILPVSIKSL GSFATLAN LTS+ ITMTANLLL
Sbjct: 375 ISLVALVAYIITFSFGMGAIPWVMMSEILPVSIKSLGGSFATLANMLTSWAITMTANLLL 434

Query: 552 SWSAGGTFVSYMLVSAFTLVFVVLWVPETKGRTLEEIQWSF 674
           SWSAGGTF+SYM+VSAFTLVFV+ WVPETKGRTLEEIQ+SF
Sbjct: 435 SWSAGGTFLSYMIVSAFTLVFVIFWVPETKGRTLEEIQFSF 475
  9633.m04618|protein  major facilitator superfamily protein
           Length = 447
           
 Score =  273 bits (691), Expect = 3e-73
 Identities = 138/176 (78%), Positives = 152/176 (85%)
 Frame = +3

Query: 150 AAGITNSDLATCGLGGIQVLATLVTTWLLDRAGRRILLIISSAGMTLSLLAVAVVFFIKD 329
           ++G+TNSDLATC LG IQ                     ISSAGMTLSLLAVAVVFF+KD
Sbjct: 293 SSGLTNSDLATCALGAIQ---------------------ISSAGMTLSLLAVAVVFFLKD 331

Query: 330 TVSQDSHMYYILSMVSLLAIVAYVIAFSFGMGAIPWVIMSEILPVSIKSLAGSFATLANW 509
           ++SQDSHMYY LSM+SL+A+VA+VIAFSFGMGAIPW+IMSEILPVSIKSLAGSFATLANW
Sbjct: 332 SISQDSHMYYTLSMISLVALVAFVIAFSFGMGAIPWIIMSEILPVSIKSLAGSFATLANW 391

Query: 510 LTSFGITMTANLLLSWSAGGTFVSYMLVSAFTLVFVVLWVPETKGRTLEEIQWSFR 677
           LTSFGITMTANL+LSWSAGGTFVSYM+VSAFTLVFV+LWVPETKGRTLEEIQWSFR
Sbjct: 392 LTSFGITMTANLMLSWSAGGTFVSYMVVSAFTLVFVILWVPETKGRTLEEIQWSFR 447
  9639.m03910|protein  Similar to sugar transporter-like protein
           Length = 402
           
 Score =  185 bits (466), Expect = 8e-47
 Identities = 96/213 (45%), Positives = 132/213 (61%)
 Frame = +3

Query: 33  QELNQKKFRMPLILGIGLLVLQQLSGINAILFYASSIFKAAGITNSDLATCGLGGIQVLA 212
           Q+L  + +  P+I+G+GL+V QQ  GIN ILFYAS  F +AG  + DL T  +G IQ   
Sbjct: 207 QDLFNRAYIRPVIVGVGLMVFQQFVGINGILFYASETFVSAGFASGDLGTILMGCIQAPI 266

Query: 213 TLVTTWLLDRAGRRILLIISSAGMTLSLLAVAVVFFIKDTVSQDSHMYYILSMVSLLAIV 392
           T V   L+DR+GRR LL+IS++G+ +  L  AV F++K                      
Sbjct: 267 TAVGALLMDRSGRRPLLLISTSGLLIGSLMSAVSFYLK---------------------- 304

Query: 393 AYVIAFSFGMGAIPWVIMSEILPVSIKSLAGSFATLANWLTSFGITMTANLLLSWSAGGT 572
            Y+ ++S GMGA+PWVIMSEI P++IK + GSF TL NW  S+ ++   N  +SWS+ GT
Sbjct: 305 VYIASYSIGMGAVPWVIMSEIFPINIKGIGGSFVTLVNWSGSWAVSFAFNFFMSWSSSGT 364

Query: 573 FVSYMLVSAFTLVFVVLWVPETKGRTLEEIQWS 671
           F  + LV A  ++F+V  VPETKG+TLEEIQ S
Sbjct: 365 FFLFALVCAVAILFIVKIVPETKGKTLEEIQAS 397
  9631.m02426|protein  BT000608 At5g18840/F17K4_90
           Length = 502
           
 Score =  175 bits (440), Expect = 9e-44
 Identities = 91/213 (42%), Positives = 138/213 (64%)
 Frame = +3

Query: 27  RFQELNQKKFRMPLILGIGLLVLQQLSGINAILFYASSIFKAAGITNSDLATCGLGGIQV 206
           R Q+L  +K    + +G+GL++ QQL GIN + FYASSIF +AG +   L T  +G IQ+
Sbjct: 282 RVQDLFLRKNIYAVTVGVGLMIFQQLGGINGVGFYASSIFTSAGFSGK-LGTILIGIIQI 340

Query: 207 LATLVTTWLLDRAGRRILLIISSAGMTLSLLAVAVVFFIKDTVSQDSHMYYILSMVSLLA 386
             TL    L+D++GRR+LL++S++G  L      + F++K   +Q     ++  + +L  
Sbjct: 341 PITLFGAILMDKSGRRVLLMVSASGTFLGCFLTGISFYLK---AQGLFSEWVPEL-ALTG 396

Query: 387 IVAYVIAFSFGMGAIPWVIMSEILPVSIKSLAGSFATLANWLTSFGITMTANLLLSWSAG 566
           I+ Y+ A+S GMG +PWV+MSEI  + +K++ GS  TL +WL SF I+ + + L+ WS+ 
Sbjct: 397 ILVYIGAYSIGMGPVPWVVMSEIFSIDMKAIGGSLVTLVSWLGSFAISYSFSFLMDWSSA 456

Query: 567 GTFVSYMLVSAFTLVFVVLWVPETKGRTLEEIQ 665
           GTF  +   S  T++FVV+ VPETKGRTLEEIQ
Sbjct: 457 GTFFMFSAASLITILFVVMVVPETKGRTLEEIQ 489
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59001132 Number of Sequences: 59712 Number of extensions: 1460504 Number of successful extensions: 5182 Number of sequences better than 1.0e-10: 88 Number of HSP's better than 0.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 55 Number of HSP's that attempted gapping in prelim test: 5013 Number of HSP's gapped (non-prelim): 86 length of query: 340 length of database: 26,991,925 effective HSP length: 51 effective length of query: 288 effective length of database: 23,946,613 effective search space: 6896624544 effective search space used: 6896624544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG888   Members:314            3pri:Y   1e-109      
NP_172750.1      calcium-binding protein, calreticulin -related
[Arabidopsis thaliana]
         (1536 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9632.m03644|protein  glyceraldehyde-3-phosphate dehydrogen...   748  0.0
 9631.m00283|protein  glyceraldehyde-3-phosphate dehydrogen...   560  e-159
 9634.m04429|protein  glyceraldehyde-3-phosphate dehydrogen...   309  1e-83
 9630.m00697|protein  glyceraldehyde-3-phosphate dehydrogen...   308  2e-83
 9636.m00238|protein  glyceraldehyde-3-phosphate dehydrogen...   301  2e-81
 9632.m03894|protein  glyceraldehyde-3-phosphate dehydrogen...   295  1e-79
 9630.m03747|protein  glyceraldehyde-3-phosphate dehydrogen...   289  6e-78
 9636.m00239|protein  glyceraldehyde-3-phosphate dehydrogen...   280  4e-75
 9630.m03748|protein  glyceraldehyde-3-phosphate dehydrogen...   280  5e-75
 9636.m00240|protein  glyceraldehyde-3-phosphate dehydrogen...   279  9e-75
 9632.m03895|protein  glyceraldehyde-3-phosphate dehydrogen...   272  9e-73
 9629.m05120|protein  retrotransposon protein, putative, Ty...    96  2e-19
 9639.m04036|protein  transposon protein, putative, CACTA, ...    90  1e-17
 9631.m03557|protein  putative protein kinase                     89  2e-17
 9632.m03281|protein  transposon protein, putative, CACTA, ...    87  6e-17
 9632.m03280|protein  transposon protein, putative, CACTA, ...    87  6e-17
 9636.m00525|protein  dna-directed rna polymerase ii larges...    84  7e-16
 9629.m00111|protein  transposon protein, putative, CACTA, ...    82  3e-15
 9629.m00112|protein  transposon protein, putative, CACTA, ...    82  3e-15
 9629.m00408|protein  expressed protein                           81  5e-15

  9632.m03644|protein  glyceraldehyde-3-phosphate dehydrogenase, type I
            Length = 402
            
 Score =  748 bits (1910), Expect = 0.0
 Identities = 375/401 (93%), Positives = 388/401 (96%), Gaps = 1/401 (0%)
 Frame = +2

Query: 23   MASPMLSTAMAPLQGGML-EFSGLRSSSSLPLRRNATSDDFMSAVSFRTYAVSTSGGSRK 199
            MASPMLS A  PLQGG L EFSGLRSSSSLPLRRNATSDDFM+AVSFRT+AV TSGG+R+
Sbjct: 1    MASPMLSAATVPLQGGGLSEFSGLRSSSSLPLRRNATSDDFMNAVSFRTHAVGTSGGARR 60

Query: 200  APTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIAINDTGGVKQASHLLKYDSTLGI 379
            APTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPL+VIAINDTGGVKQASHLLKYDSTLGI
Sbjct: 61   APTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLDVIAINDTGGVKQASHLLKYDSTLGI 120

Query: 380  FDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMGIDLVIEGTGVFVDRAGAGKHLEA 559
            FDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGE+GIDLVIEGTGVFVDR GAGKH++A
Sbjct: 121  FDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKHIQA 180

Query: 560  GAKKVLITAPGKGDIPTYVCGVNADLYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKG 739
            GAKKVLITAPGKGDIPTYV GVNAD Y+  + IISNASCTTNCLAPFVK+LDQKFGIIKG
Sbjct: 181  GAKKVLITAPGKGDIPTYVVGVNADQYSPDEPIISNASCTTNCLAPFVKILDQKFGIIKG 240

Query: 740  TMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALR 919
            TMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALR
Sbjct: 241  TMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALR 300

Query: 920  VPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVSST 1099
            VPTPNVSVVDLVVQVSKKTLAEEVNQAFRD+AANELKGIL+VCD PLVSVDFRCSDVS T
Sbjct: 301  VPTPNVSVVDLVVQVSKKTLAEEVNQAFRDSAANELKGILEVCDVPLVSVDFRCSDVSCT 360

Query: 1100 IDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK 1225
            IDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct: 361  IDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK 402
  9631.m00283|protein  glyceraldehyde-3-phosphate dehydrogenase, type
            I, putative
            Length = 444
            
 Score =  560 bits (1428), Expect = e-159
 Identities = 292/401 (72%), Positives = 328/401 (80%), Gaps = 3/401 (0%)
 Frame = +2

Query: 77   EFSGLRSSSSLPLRRNATSDDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGR 256
            +FSGLR  S   +   A    F   +  +  A +T   + +AP EAKLKVAINGFGRIGR
Sbjct: 32   DFSGLRPGSC-SISHAAREASFSDVLGSQLVARATGENAVRAPAEAKLKVAINGFGRIGR 90

Query: 257  NFLRCWHGRGDSSPLEVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKV 436
            NFLRCWH R ++SPLEV+ +ND+GGV+ ASHLLKYDS LG F ADVK V D  ISVDGK+
Sbjct: 91   NFLRCWHER-ENSPLEVVVVNDSGGVRNASHLLKYDSMLGTFKADVKIVDDQTISVDGKL 149

Query: 437  IKVVSDRNPSNLPWGEMGIDLVIEGTGVFVDRAGAGKHLEAGAKKVLITAPGKG-DIPTY 613
            IKVVS+R+P  LPW E+GID+VIEGTGVFVD  GAGKH++AGAKKV+ITAP KG DIPTY
Sbjct: 150  IKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY 209

Query: 614  VCGVNADLYTH-ADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDA 790
            V GVN   Y+H    IISNASCTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDA
Sbjct: 210  VLGVNEGDYSHEVANIISNASCTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDA 269

Query: 791  SHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSK 970
            SHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+   K
Sbjct: 270  SHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVK 329

Query: 971  KTL-AEEVNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKV 1147
              + A++VN AFR AAA  L GILDVCD PLVSVDFRCSDVSSTIDASL+MVMGDDMVKV
Sbjct: 330  TGITADDVNAAFRKAAAGPLSGILDVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKV 389

Query: 1148 IAWYDNEWGYSQRVVDLADIVANQWK*TPPTAALPCQVTPLEIF 1279
            +AWYDNEWGYSQRVVDLA +VA++W    P AA+     PLE F
Sbjct: 390  VAWYDNEWGYSQRVVDLAHLVASKW----PGAAVQGSGDPLEDF 429
  9634.m04429|protein  glyceraldehyde-3-phosphate dehydrogenase, type
            I, putative
            Length = 415
            
 Score =  309 bits (782), Expect = 1e-83
 Identities = 165/358 (46%), Positives = 223/358 (62%), Gaps = 2/358 (0%)
 Frame = +2

Query: 125  ATSDDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLE 304
            A+S    S    R  A      + ++ +  K KV INGFGRIGR  LR    R D   +E
Sbjct: 49   ASSSLASSVEPVRATATQAPLATHQSSSTEKTKVGINGFGRIGRLVLRIATNRDD---IE 105

Query: 305  VIAINDTG-GVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWG 481
            V+A+ND     K  +++ KYDST G F   +K V ++ + ++GK I V S R+PS++PWG
Sbjct: 106  VVAVNDPFIDAKYMAYMFKYDSTHGPFKGTIKVVDESTLEINGKKISVTSKRDPSDIPWG 165

Query: 482  EMGIDLVIEGTGVFVDRAGAGKHLEAGAKKVLITAPGKGDIPTYVCGVNADLYTHADTII 661
              G + V+E +GVF     A  HL+ GA+KV+I+AP   D P +V GVN   Y  +  ++
Sbjct: 166  NFGAEYVVESSGVFTTTEKASAHLKGGARKVVISAPS-ADAPMFVVGVNEKNYNPSMNVV 224

Query: 662  SNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDA-SHRDLRRARAAALNIV 838
            SNASCTTNCLAP  K++ ++FGI +G MTT H+ T  Q+ +D  S +D R  R A+ NI+
Sbjct: 225  SNASCTTNCLAPLAKIVHEEFGIAEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNII 284

Query: 839  PTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAA 1018
            P+STGAAKAV  VLP L GKL G+A RVPTPNVSVVDL  ++ K    E+V  A ++A+ 
Sbjct: 285  PSSTGAAKAVGKVLPALNGKLTGMAFRVPTPNVSVVDLTCRLEKSASYEDVKAAIKEASE 344

Query: 1019 NELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDL 1198
              LKGIL   DE +VS DF     SS  DA   + +    +K+++WYDNEWGYS RV+DL
Sbjct: 345  GSLKGILGYTDEDVVSNDFIGDTRSSIFDAKAGIGLSSSFMKLVSWYDNEWGYSNRVLDL 404
  9630.m00697|protein  glyceraldehyde-3-phosphate dehydrogenase, type
            I, putative
            Length = 474
            
 Score =  308 bits (780), Expect = 2e-83
 Identities = 160/328 (48%), Positives = 212/328 (63%), Gaps = 2/328 (0%)
 Frame = +2

Query: 215  KLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIAINDTG-GVKQASHLLKYDSTLGIFDAD 391
            K KV INGFGRIGR  LR    R D   +EV+A+ND     K  +++ KYDST G F   
Sbjct: 138  KTKVGINGFGRIGRLVLRIATSRDD---IEVVAVNDPFIDAKYMAYMFKYDSTHGPFKGS 194

Query: 392  VKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMGIDLVIEGTGVFVDRAGAGKHLEAGAKK 571
            +K V D+ + ++GK + + S R+P+++PWG  G + V+E +GVF     A  HL+ GAKK
Sbjct: 195  IKVVDDSTLEINGKKVTITSKRDPADIPWGNFGAEYVVESSGVFTTTEKASAHLKGGAKK 254

Query: 572  VLITAPGKGDIPTYVCGVNADLYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTT 751
            V+I+AP   D P +V GVN   Y     ++SNASCTTNCLAP  KV+ ++FGI++G MTT
Sbjct: 255  VVISAPS-ADAPMFVVGVNEKSYDPKMNVVSNASCTTNCLAPLAKVVHEEFGIVEGLMTT 313

Query: 752  THSYTGDQRLLDA-SHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPT 928
             H+ T  Q+ +D  S +D R  R AA NI+P+STGAAKAV  VLP L GKL G+A RVPT
Sbjct: 314  VHATTATQKTVDGPSMKDWRGGRGAAQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPT 373

Query: 929  PNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDA 1108
            PNVSVVDL  ++ K    ++V  A + A+   LKGIL   DE +VS DF     SS  DA
Sbjct: 374  PNVSVVDLTCRIEKSASYDDVKAAIKAASEGALKGILGYTDEDVVSNDFVGDARSSIFDA 433

Query: 1109 SLSMVMGDDMVKVIAWYDNEWGYSQRVVDL 1198
               + +    +K+++WYDNEWGYS RV+DL
Sbjct: 434  KAGIGLSSSFMKLVSWYDNEWGYSNRVLDL 463
  9636.m00238|protein  glyceraldehyde-3-phosphate dehydrogenase, type I
            Length = 337
            
 Score =  301 bits (763), Expect = 2e-81
 Identities = 158/328 (48%), Positives = 211/328 (64%), Gaps = 3/328 (0%)
 Frame = +2

Query: 215  KLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIAINDTG-GVKQASHLLKYDSTLGIFD-A 388
            K+K+ INGFGRIGR   R       S  +E++A+ND        +++ KYD+  G +  +
Sbjct: 3    KIKIGINGFGRIGRLVARV---ALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHS 59

Query: 389  DVKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMGIDLVIEGTGVFVDRAGAGKHLEAGAK 568
            D+K      + +  K + V   RNP  +PW E G + V+E TGVF D+  A  HL+ GAK
Sbjct: 60   DIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAK 119

Query: 569  KVLITAPGKGDIPTYVCGVNADLYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMT 748
            KV+I+AP K D P +VCGVN D YT    I+SNASCTTNCLAP  KV+   FGII+G MT
Sbjct: 120  KVVISAPSK-DAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMT 178

Query: 749  TTHSYTGDQRLLDA-SHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVP 925
            T H+ T  Q+ +D  S +D R  RAA+ NI+P+STGAAKAV  VLP+L GKL G++ RVP
Sbjct: 179  TVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVP 238

Query: 926  TPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTID 1105
            T +VSVVDL V++ K    + +  A + A+  +LKGI+   +E LVS DF     SS  D
Sbjct: 239  TVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSRSSIFD 298

Query: 1106 ASLSMVMGDDMVKVIAWYDNEWGYSQRVVDL 1198
            A   + + D+ VK++AWYDNEWGYS RV+DL
Sbjct: 299  AKAGIALNDNFVKLVAWYDNEWGYSNRVIDL 329
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 116390734 Number of Sequences: 59712 Number of extensions: 4486352 Number of successful extensions: 89894 Number of sequences better than 1.0e-10: 49 Number of HSP's better than 0.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 23 Number of HSP's that attempted gapping in prelim test: 87615 Number of HSP's gapped (non-prelim): 267 length of query: 512 length of database: 26,991,925 effective HSP length: 52 effective length of query: 459 effective length of database: 23,886,901 effective search space: 10964087559 effective search space used: 10964087559 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG892   Members:47             3pri:Y   1e-126      
AAO72551.1       DNAJ-like protein [Oryza sativa (japonica
cultivar-group)]
         (1744 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9631.m04311|protein  DnaJ central domain (4 repeats), puta...   790  0.0
 9631.m04312|protein  DnaJ central domain (4 repeats), puta...   787  0.0
 9631.m05629|protein  dnaJ protein homolog - potato              756  0.0
 9630.m04241|protein  DnaJ-like protein                          640  0.0
 9630.m04240|protein  DnaJ-like protein                          638  0.0
 9640.m04169|protein  Similar to dnaj protein homolog 2. [leek   328  2e-89
 9633.m00566|protein  DnaJ domain, putative                      232  2e-60
 9632.m04469|protein  DnaJ domain, putative                      231  3e-60
 9633.m00289|protein  heat shock protein, putative               211  3e-54
 9630.m05561|protein  expressed protein                          199  1e-50
 9633.m04568|protein  Similar to probable heat shock protei...   192  2e-48
 9633.m04567|protein  Similar to probable heat shock protei...   191  3e-48
 9633.m02439|protein  DNAJ homologue                             178  2e-44
 9633.m02436|protein  DNAJ homologue                             178  2e-44
 9636.m00581|protein  DnaJ domain, putative                      173  1e-42
 9629.m01353|protein  DnaJ domain, putative                      172  1e-42
 9634.m00168|protein  Similar to DnaJ protein                    170  6e-42
 9631.m01145|protein  DnaJ domain, putative                      127  8e-29
 9634.m01117|protein  transposon protein, putative, mariner...   116  9e-26
 9633.m03287|protein  DnaJ domain, putative                      112  2e-24

  9631.m04311|protein  DnaJ central domain (4 repeats), putative
            Length = 417
            
 Score =  790 bits (2017), Expect = 0.0
 Identities = 385/422 (91%), Positives = 405/422 (95%), Gaps = 1/422 (0%)
 Frame = +3

Query: 126  MFGRTPKKSDNTKYYEVLGVPKDAAQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV 305
            MFGR PKKSDNTKYYE+LGVPK A+QDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct: 1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV 60

Query: 306  LSDPEKREIYDKYGEDALKEGMGGGGGGGVDPFDIFSSFFGPSFGGGGGGSSRGRRQRRG 485
            LSDPEKREIYD+YGEDALKEGMGGGG   VDPFDIFSSFFGPSFGGGG  SSRGRRQRRG
Sbjct: 61   LSDPEKREIYDQYGEDALKEGMGGGGSH-VDPFDIFSSFFGPSFGGGG--SSRGRRQRRG 117

Query: 486  EDVVHPLKASLEDLYNGTSKKLSLSRSVLCSKCKGKGSKSGASMRCPGCQGSGMKVTIRQ 665
            EDV+HPLK SLEDLYNGTSKKLSLSR+VLC+KCKGKGSKSGASMRCPGCQGSGMK+TIRQ
Sbjct: 118  EDVIHPLKVSLEDLYNGTSKKLSLSRNVLCAKCKGKGSKSGASMRCPGCQGSGMKITIRQ 177

Query: 666  LGPSMIQQVQHACNDCKGTGESINDKDRCPGCKGEKVLQEKKVLEVHVEKGMQHNQKITF 845
            LGPSMIQQ+Q  CN+CKGTGESIN+KDRCPGCKGEKV+QEKKVLEVHVEKGMQHNQKITF
Sbjct: 178  LGPSMIQQMQQPCNECKGTGESINEKDRCPGCKGEKVIQEKKVLEVHVEKGMQHNQKITF 237

Query: 846  PGEADEAPDTVTGDIVFVVQQKEHPKFKRKGDDLFYEHTISLTEALCGFQLVLTHLDNRQ 1025
            PGEADEAPDTVTGDIVFV+QQK+H KFKRKGDDLFYEHT+SLTEALCGFQ VLTHLDNRQ
Sbjct: 238  PGEADEAPDTVTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALCGFQFVLTHLDNRQ 297

Query: 1026 LLIKSNPGEVVKPDSFKAISDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPDQCKALEAVL 1205
            LLIKSNPGEVVKPD FKAI+DEGMPMYQRPFMKGKLYIHFTVEFPDSLAP+QCKALEAVL
Sbjct: 298  LLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPEQCKALEAVL 357

Query: 1206 PPKPASKLTDMELDECEETTMHDV-NMEEEMRRKAHAAAQEAYDEDDDEMPGGGAQRVQC 1382
            PPKPAS+LT+ME+DECEETTMHDV N+EEEMRRKA  AAQEAYDE DDEMP GGAQRVQC
Sbjct: 358  PPKPASQLTEMEIDECEETTMHDVNNIEEEMRRKAQ-AAQEAYDE-DDEMP-GGAQRVQC 414

Query: 1383 AQQ 1391
            AQQ
Sbjct: 415  AQQ 417
  9631.m04312|protein  DnaJ central domain (4 repeats), putative
            Length = 416
            
 Score =  787 bits (2010), Expect = 0.0
 Identities = 384/422 (90%), Positives = 404/422 (94%), Gaps = 1/422 (0%)
 Frame = +3

Query: 126  MFGRTPKKSDNTKYYEVLGVPKDAAQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV 305
            MFGR PKKSDNTKYYE+LGVPK A+QDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct: 1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV 60

Query: 306  LSDPEKREIYDKYGEDALKEGMGGGGGGGVDPFDIFSSFFGPSFGGGGGGSSRGRRQRRG 485
            LSDPEKREIYD+YGEDALKEGMGGGG   VDPFDIFSSFFGPSFGGG   SSRGRRQRRG
Sbjct: 61   LSDPEKREIYDQYGEDALKEGMGGGGSH-VDPFDIFSSFFGPSFGGG---SSRGRRQRRG 116

Query: 486  EDVVHPLKASLEDLYNGTSKKLSLSRSVLCSKCKGKGSKSGASMRCPGCQGSGMKVTIRQ 665
            EDV+HPLK SLEDLYNGTSKKLSLSR+VLC+KCKGKGSKSGASMRCPGCQGSGMK+TIRQ
Sbjct: 117  EDVIHPLKVSLEDLYNGTSKKLSLSRNVLCAKCKGKGSKSGASMRCPGCQGSGMKITIRQ 176

Query: 666  LGPSMIQQVQHACNDCKGTGESINDKDRCPGCKGEKVLQEKKVLEVHVEKGMQHNQKITF 845
            LGPSMIQQ+Q  CN+CKGTGESIN+KDRCPGCKGEKV+QEKKVLEVHVEKGMQHNQKITF
Sbjct: 177  LGPSMIQQMQQPCNECKGTGESINEKDRCPGCKGEKVIQEKKVLEVHVEKGMQHNQKITF 236

Query: 846  PGEADEAPDTVTGDIVFVVQQKEHPKFKRKGDDLFYEHTISLTEALCGFQLVLTHLDNRQ 1025
            PGEADEAPDTVTGDIVFV+QQK+H KFKRKGDDLFYEHT+SLTEALCGFQ VLTHLDNRQ
Sbjct: 237  PGEADEAPDTVTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALCGFQFVLTHLDNRQ 296

Query: 1026 LLIKSNPGEVVKPDSFKAISDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPDQCKALEAVL 1205
            LLIKSNPGEVVKPD FKAI+DEGMPMYQRPFMKGKLYIHFTVEFPDSLAP+QCKALEAVL
Sbjct: 297  LLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPEQCKALEAVL 356

Query: 1206 PPKPASKLTDMELDECEETTMHDV-NMEEEMRRKAHAAAQEAYDEDDDEMPGGGAQRVQC 1382
            PPKPAS+LT+ME+DECEETTMHDV N+EEEMRRKA  AAQEAYDE DDEMP GGAQRVQC
Sbjct: 357  PPKPASQLTEMEIDECEETTMHDVNNIEEEMRRKAQ-AAQEAYDE-DDEMP-GGAQRVQC 413

Query: 1383 AQQ 1391
            AQQ
Sbjct: 414  AQQ 416
  9631.m05629|protein  dnaJ protein homolog - potato
            Length = 417
            
 Score =  756 bits (1930), Expect = 0.0
 Identities = 365/422 (86%), Positives = 389/422 (91%)
 Frame = +3

Query: 126  MFGRTPKKSDNTKYYEVLGVPKDAAQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV 305
            MFGR PKKSDNT+YYEVLGVPKDA+QDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct: 1    MFGRAPKKSDNTRYYEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV 60

Query: 306  LSDPEKREIYDKYGEDALKEGMGGGGGGGVDPFDIFSSFFGPSFGGGGGGSSRGRRQRRG 485
            LSDPEKREIYD+YGEDALKEGMG GGG   DPFDIFSSFFG   GG GGGSSRGRRQRRG
Sbjct: 61   LSDPEKREIYDQYGEDALKEGMGPGGGMH-DPFDIFSSFFG---GGFGGGSSRGRRQRRG 116

Query: 486  EDVVHPLKASLEDLYNGTSKKLSLSRSVLCSKCKGKGSKSGASMRCPGCQGSGMKVTIRQ 665
            EDVVHPLK SLE+LYNGTSKKLSLSR+VLCSKC GKGSKSGASM+C GCQGSGMKV IRQ
Sbjct: 117  EDVVHPLKVSLEELYNGTSKKLSLSRNVLCSKCNGKGSKSGASMKCSGCQGSGMKVQIRQ 176

Query: 666  LGPSMIQQVQHACNDCKGTGESINDKDRCPGCKGEKVLQEKKVLEVHVEKGMQHNQKITF 845
            LGP MIQQ+QH CN+CKGTGE+I+DKDRCPGCKGEKV QEKKVLEV VEKGMQ+ QKITF
Sbjct: 177  LGPGMIQQMQHPCNECKGTGETISDKDRCPGCKGEKVAQEKKVLEVVVEKGMQNGQKITF 236

Query: 846  PGEADEAPDTVTGDIVFVVQQKEHPKFKRKGDDLFYEHTISLTEALCGFQLVLTHLDNRQ 1025
            PGEADEAPDTVTGDI+FV+QQKEHPKFKRKGDDLFYEHT++LTEALCGFQ VLTHLDNRQ
Sbjct: 237  PGEADEAPDTVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLNLTEALCGFQFVLTHLDNRQ 296

Query: 1026 LLIKSNPGEVVKPDSFKAISDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPDQCKALEAVL 1205
            LLIKS PGEVVKPDSFKA++DEGMPMYQRPFMKGKLYIHF+VEFPDSL PDQCKALE VL
Sbjct: 297  LLIKSKPGEVVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPDQCKALETVL 356

Query: 1206 PPKPASKLTDMELDECEETTMHDVNMEEEMRRKAHAAAQEAYDEDDDEMPGGGAQRVQCA 1385
            PP+P S+ TDMELDECEET  +DVN+EEEMRR+     QEAYDED+D M GGGAQRVQCA
Sbjct: 357  PPRPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQQQQEAYDEDED-MHGGGAQRVQCA 415

Query: 1386 QQ 1391
            QQ
Sbjct: 416  QQ 417
  9630.m04241|protein  DnaJ-like protein
            Length = 421
            
 Score =  640 bits (1632), Expect = 0.0
 Identities = 308/422 (72%), Positives = 351/422 (82%), Gaps = 3/422 (0%)
 Frame = +3

Query: 126  MFGRTPKKSDNTKYYEVLGVPKDAAQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV 305
            M+GR PKKS+NTKYYEVLGV K A QD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct: 1    MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV 60

Query: 306  LSDPEKREIYDKYGEDALKEGMGGGGGGGV-DPFDIFSSFFGPSFGGGGGGSSRGRRQRR 482
            L+DPEKREIYD+YGEDALKEGMGGG       PFD+F   F      GG G  RG RQ+R
Sbjct: 61   LNDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDLFEQIFQ---NRGGFGVGRGHRQKR 117

Query: 483  GEDVVHPLKASLEDLYNGTSKKLSLSRSVLCSKCKGKGSKSGASMRCPGCQGSGMKVTIR 662
            GEDVVH +K SLEDLYNGT+KKLSLSR+ LC+KCKGKGSKSGA+  C GC G+GM+   R
Sbjct: 118  GEDVVHTMKVSLEDLYNGTTKKLSLSRNALCTKCKGKGSKSGAAATCHGCHGAGMRTITR 177

Query: 663  QLGPSMIQQVQHACNDCKGTGESINDKDRCPGCKGEKVLQEKKVLEVHVEKGMQHNQKIT 842
            Q+G  MIQQ+   C +C+G+GE I+DKD+CP CKG KV+Q+KKVLEVHVEKGMQH QKI 
Sbjct: 178  QIGLGMIQQMNTVCPECRGSGEMISDKDKCPSCKGNKVVQQKKVLEVHVEKGMQHGQKIV 237

Query: 843  FPGEADEAPDTVTGDIVFVVQQKEHPKFKRKGDDLFYEHTISLTEALCGFQLVLTHLDNR 1022
            F GEADEAPDTVTGDIVFV+Q K+HPKFKRK DDLF EHTISLTEALCGFQ VLTHLD R
Sbjct: 238  FQGEADEAPDTVTGDIVFVLQLKDHPKFKRKFDDLFTEHTISLTEALCGFQFVLTHLDGR 297

Query: 1023 QLLIKSNPGEVVKPDSFKAISDEGMPMYQRPFMKGKLYIHFTVEFPD--SLAPDQCKALE 1196
            QLLIKSNPGEV+KP   KAI+DEGMP + RPFMKG+L++ F VEFP+  +L P QC++LE
Sbjct: 298  QLLIKSNPGEVIKPGQHKAINDEGMPQHGRPFMKGRLFVEFNVEFPEPGALTPGQCRSLE 357

Query: 1197 AVLPPKPASKLTDMELDECEETTMHDVNMEEEMRRKAHAAAQEAYDEDDDEMPGGGAQRV 1376
             +LPP+P ++L+DMELD+CEETTMHDVN+EEEMRR+     QEAYDEDDDE  G G  RV
Sbjct: 358  KILPPRPRNQLSDMELDQCEETTMHDVNIEEEMRRRQQHRRQEAYDEDDDEDAGAG-PRV 416

Query: 1377 QCAQQ 1391
            QCAQQ
Sbjct: 417  QCAQQ 421
  9630.m04240|protein  DnaJ-like protein
            Length = 420
            
 Score =  638 bits (1629), Expect = 0.0
 Identities = 308/422 (72%), Positives = 351/422 (82%), Gaps = 3/422 (0%)
 Frame = +3

Query: 126  MFGRTPKKSDNTKYYEVLGVPKDAAQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV 305
            M+GR PKKS+NTKYYEVLGV K A QD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct: 1    MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV 60

Query: 306  LSDPEKREIYDKYGEDALKEGMGGGGGGGV-DPFDIFSSFFGPSFGGGGGGSSRGRRQRR 482
            L+DPEKREIYD+YGEDALKEGMGGG       PFD+F   F    G GG    RG RQ+R
Sbjct: 61   LNDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDLFEQIFQNRGGFGG----RGHRQKR 116

Query: 483  GEDVVHPLKASLEDLYNGTSKKLSLSRSVLCSKCKGKGSKSGASMRCPGCQGSGMKVTIR 662
            GEDVVH +K SLEDLYNGT+KKLSLSR+ LC+KCKGKGSKSGA+  C GC G+GM+   R
Sbjct: 117  GEDVVHTMKVSLEDLYNGTTKKLSLSRNALCTKCKGKGSKSGAAATCHGCHGAGMRTITR 176

Query: 663  QLGPSMIQQVQHACNDCKGTGESINDKDRCPGCKGEKVLQEKKVLEVHVEKGMQHNQKIT 842
            Q+G  MIQQ+   C +C+G+GE I+DKD+CP CKG KV+Q+KKVLEVHVEKGMQH QKI 
Sbjct: 177  QIGLGMIQQMNTVCPECRGSGEMISDKDKCPSCKGNKVVQQKKVLEVHVEKGMQHGQKIV 236

Query: 843  FPGEADEAPDTVTGDIVFVVQQKEHPKFKRKGDDLFYEHTISLTEALCGFQLVLTHLDNR 1022
            F GEADEAPDTVTGDIVFV+Q K+HPKFKRK DDLF EHTISLTEALCGFQ VLTHLD R
Sbjct: 237  FQGEADEAPDTVTGDIVFVLQLKDHPKFKRKFDDLFTEHTISLTEALCGFQFVLTHLDGR 296

Query: 1023 QLLIKSNPGEVVKPDSFKAISDEGMPMYQRPFMKGKLYIHFTVEFPD--SLAPDQCKALE 1196
            QLLIKSNPGEV+KP   KAI+DEGMP + RPFMKG+L++ F VEFP+  +L P QC++LE
Sbjct: 297  QLLIKSNPGEVIKPGQHKAINDEGMPQHGRPFMKGRLFVEFNVEFPEPGALTPGQCRSLE 356

Query: 1197 AVLPPKPASKLTDMELDECEETTMHDVNMEEEMRRKAHAAAQEAYDEDDDEMPGGGAQRV 1376
             +LPP+P ++L+DMELD+CEETTMHDVN+EEEMRR+     QEAYDEDDDE  G G  RV
Sbjct: 357  KILPPRPRNQLSDMELDQCEETTMHDVNIEEEMRRRQQHRRQEAYDEDDDEDAGAG-PRV 415

Query: 1377 QCAQQ 1391
            QCAQQ
Sbjct: 416  QCAQQ 420
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 121564168 Number of Sequences: 59712 Number of extensions: 4016774 Number of successful extensions: 66305 Number of sequences better than 1.0e-10: 61 Number of HSP's better than 0.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 26 Number of HSP's that attempted gapping in prelim test: 66119 Number of HSP's gapped (non-prelim): 61 length of query: 581 length of database: 26,991,925 effective HSP length: 52 effective length of query: 528 effective length of database: 23,886,901 effective search space: 12612283728 effective search space used: 12612283728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 161 (67.1 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG899   Members:228            3pri:Y   1e-124      
S53126           dnaK-type molecular chaperone hsp70 - rice (fragment)
         (2229 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9631.m01647|protein  dnaK protein                              1268  0.0
 9639.m04467|protein  dnaK-type molecular chaperone hsp70 -...  1218  0.0
 9633.m03578|protein  dnaK protein                              1213  0.0
 9631.m05972|protein  heat shock protein cognate 70             1211  0.0
 9629.m06146|protein  dnaK protein                              1209  0.0
 9631.m01656|protein  heat shock cognate 70 kda protein         1170  0.0
 9639.m04468|protein  dnaK-type molecular chaperone hsp70 -...  1113  0.0
 9633.m03577|protein  dnaK protein                              1044  0.0
 9630.m00144|protein  dnaK-type molecular chaperone BiP - rice   821  0.0
 9631.m01650|protein  dnaK protein                               780  0.0
 9631.m04907|protein  putative luminal binding protein           774  0.0
 9633.m03294|protein  luminal binding protein 5 precursor (...   772  0.0
 9636.m04621|protein  BiP-isoform D                              758  0.0
 9633.m02768|protein  luminal binding protein 4 precursor (...   732  0.0
 9639.m00793|protein  dnaK protein, putative                     643  0.0
 9629.m04774|protein  dnaK protein                               573  e-163
 9639.m00795|protein  Similar to dnaK-type molecular chaper...   573  e-163
 9630.m05282|protein  dnaK protein                               565  e-161
 9631.m00134|protein  dnaK protein                               555  e-158
 9639.m00796|protein  Similar to hsp70                           551  e-156

  9631.m01647|protein  dnaK protein
            Length = 650
            
 Score = 1268 bits (3244), Expect = 0.0
 Identities = 628/651 (96%), Positives = 646/651 (98%)
 Frame = +1

Query: 97   MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 276
            MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct: 1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN 60

Query: 277  QVAMNPINTVFDAKRLIGRRFSDASVQSDAKLWPFKVIPGPADKPMIGVQYRGEDKQFSA 456
            QVAMNPINTVFDAKRLIGRRFSD SVQSDAKLWPFKV+PGP DKPMIGVQY+GE+KQFSA
Sbjct: 61   QVAMNPINTVFDAKRLIGRRFSDTSVQSDAKLWPFKVLPGPGDKPMIGVQYKGEEKQFSA 120

Query: 457  EEISSMVLNKMKETAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP 636
            EEISSMVLNKMKETAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP
Sbjct: 121  EEISSMVLNKMKETAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP 180

Query: 637  TAAAIAYGLDKKSTSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 816
            TAAAIAYGLDKKS+SVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
Sbjct: 181  TAAAIAYGLDKKSSSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240

Query: 817  NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFY 996
            NRMVNHFVQEFKRKNKKDI+GNPRALRRLRTACERAKRTLSSTAQTTIEIDSL+EGIDFY
Sbjct: 241  NRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY 300

Query: 997  TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFF 1176
            TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFF
Sbjct: 301  TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFF 360

Query: 1177 NGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLI 1356
            NGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLI
Sbjct: 361  NGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLI 420

Query: 1357 PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQI 1536
            PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RTKDNNLLGKFELSGIPPAPRGVPQI
Sbjct: 421  PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQI 480

Query: 1537 TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKK 1716
            TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKK
Sbjct: 481  TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKK 540

Query: 1717 KVDSKNALENYAYNMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADEFDD 1896
            KVD+KN+LENYAYNMRNTIKDDKIASKLPEADKKKIEDAI+GAI+WLD+NQLAEA+EF+D
Sbjct: 541  KVDAKNSLENYAYNMRNTIKDDKIASKLPEADKKKIEDAIDGAISWLDSNQLAEAEEFED 600

Query: 1897 KMKELEGICNPIIAKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD 2049
            KMKELEG+CNPIIAKMYQGAGA+M GGMDEDAPA AAGGSSGPGPKIEEVD
Sbjct: 601  KMKELEGVCNPIIAKMYQGAGADMAGGMDEDAPA-AAGGSSGPGPKIEEVD 650
  9639.m04467|protein  dnaK-type molecular chaperone hsp70 - rice
            (fragment)
            Length = 649
            
 Score = 1218 bits (3118), Expect = 0.0
 Identities = 610/651 (93%), Positives = 631/651 (96%)
 Frame = +1

Query: 97   MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 276
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct: 1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN 60

Query: 277  QVAMNPINTVFDAKRLIGRRFSDASVQSDAKLWPFKVIPGPADKPMIGVQYRGEDKQFSA 456
            QVAMNPINTVFDAKRLIGRRFSDASVQSD KLWPFKVI GP DKPMI VQY+GE+KQF+A
Sbjct: 61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA 120

Query: 457  EEISSMVLNKMKETAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP 636
            EEISSMVL KM+E AEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct: 121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP 180

Query: 637  TAAAIAYGLDKKSTSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 816
            TAAAIAYGLDKK+TSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
Sbjct: 181  TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240

Query: 817  NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFY 996
            NRMVNHFVQEFKRKNKKDI+GNPRALRRLRTACERAKRTLSSTAQTTIEIDSL+EGIDFY
Sbjct: 241  NRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY 300

Query: 997  TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFF 1176
            +TITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPRVQQLLQDFF
Sbjct: 301  STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQDFF 360

Query: 1177 NGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLI 1356
            NGKELCK+INPDEAVAYGAAVQAAIL+GEGNEKVQDLLLLDVTPLS GLETAGGVMTVLI
Sbjct: 361  NGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI 420

Query: 1357 PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQI 1536
            PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQI
Sbjct: 421  PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI 480

Query: 1537 TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKK 1716
            TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK+EDEEHKK
Sbjct: 481  TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK 540

Query: 1717 KVDSKNALENYAYNMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADEFDD 1896
            KV+SKNALENYAYNMRNTIKD+KIASKLP ADKKKIEDAI+ AI WLD NQLAEADEFDD
Sbjct: 541  KVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDD 600

Query: 1897 KMKELEGICNPIIAKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD 2049
            KMKELEGICNPIIAKMYQGAGA+M GGMDED  A  AGG SG GPKIEEVD
Sbjct: 601  KMKELEGICNPIIAKMYQGAGADMAGGMDED-DAPPAGG-SGAGPKIEEVD 649
  9633.m03578|protein  dnaK protein
            Length = 646
            
 Score = 1213 bits (3104), Expect = 0.0
 Identities = 604/648 (93%), Positives = 626/648 (96%)
 Frame = +1

Query: 106  KGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 285
            KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 62

Query: 286  MNPINTVFDAKRLIGRRFSDASVQSDAKLWPFKVIPGPADKPMIGVQYRGEDKQFSAEEI 465
            MNP NTVFDAKRLIGRRFSD SVQSD KLWPFKV+PGP DKPMI VQY+GE+KQF+AEEI
Sbjct: 63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAEEI 122

Query: 466  SSMVLNKMKETAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAA 645
            SSMVL KM+E AEAYLG++IKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEPTAA
Sbjct: 123  SSMVLIKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA 182

Query: 646  AIAYGLDKKSTSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRM 825
            AIAYGLDKK+TS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRM
Sbjct: 183  AIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRM 242

Query: 826  VNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFYTTI 1005
            VNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSL+EGIDFYTTI
Sbjct: 243  VNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTI 302

Query: 1006 TRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFFNGK 1185
            TRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQDFFNGK
Sbjct: 303  TRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGK 362

Query: 1186 ELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRN 1365
            ELCKSINPDEAVAYGAAVQAAIL+GEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRN
Sbjct: 363  ELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRN 422

Query: 1366 TTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVC 1545
            TTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQI VC
Sbjct: 423  TTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQINVC 482

Query: 1546 FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVD 1725
            FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKAEDEEHKKKVD
Sbjct: 483  FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVD 542

Query: 1726 SKNALENYAYNMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADEFDDKMK 1905
            +KNALENYAYNMRNTIKD+KIASKL   DKK+IEDAI+GAI+WLD NQLAEADEF+DKMK
Sbjct: 543  AKNALENYAYNMRNTIKDEKIASKLAADDKKRIEDAIDGAISWLDTNQLAEADEFEDKMK 602

Query: 1906 ELEGICNPIIAKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD 2049
            ELEGICNPIIAKMYQG GA+M GGMDEDAPA    G SG GPKIEEVD
Sbjct: 603  ELEGICNPIIAKMYQGPGADMAGGMDEDAPA----GGSGAGPKIEEVD 646
  9631.m05972|protein  heat shock protein cognate 70
            Length = 649
            
 Score = 1211 bits (3099), Expect = 0.0
 Identities = 598/648 (92%), Positives = 629/648 (96%)
 Frame = +1

Query: 106  KGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 285
            KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQVA
Sbjct: 5    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA 64

Query: 286  MNPINTVFDAKRLIGRRFSDASVQSDAKLWPFKVIPGPADKPMIGVQYRGEDKQFSAEEI 465
            MNPINTVFDAKRLIGRRFSDASVQSD K+WP+KVIPGP DKPMI VQY+GE+KQFSAEEI
Sbjct: 65   MNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEI 124

Query: 466  SSMVLNKMKETAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAA 645
            SSMVL KM+E AEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEPTAA
Sbjct: 125  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA 184

Query: 646  AIAYGLDKKSTSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRM 825
            AIAYGLDKK+TSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR+
Sbjct: 185  AIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL 244

Query: 826  VNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFYTTI 1005
            VNHFVQEFKRK+KKDISGNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLFEG+DFY+TI
Sbjct: 245  VNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGVDFYSTI 304

Query: 1006 TRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFFNGK 1185
            TRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFFNGK
Sbjct: 305  TRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFFNGK 364

Query: 1186 ELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRN 1365
            ELCKSINPDEAVAYGAAVQAAIL+GEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRN
Sbjct: 365  ELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRN 424

Query: 1366 TTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVC 1545
            TTIPTKKEQVFSTYSDNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVC
Sbjct: 425  TTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVC 484

Query: 1546 FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVD 1725
            FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQ+AEKYK+EDEEHKKKVD
Sbjct: 485  FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVD 544

Query: 1726 SKNALENYAYNMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADEFDDKMK 1905
            +KN+LENYAYNMRNTI+D+KIASKLP  DKKKIEDA+E AI WLDNNQLAE +EF+DKMK
Sbjct: 545  AKNSLENYAYNMRNTIQDEKIASKLPADDKKKIEDAVEQAIQWLDNNQLAEVEEFEDKMK 604

Query: 1906 ELEGICNPIIAKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD 2049
            ELEG+CNPIIAKMYQGAGA+M GGMD+DAPA+   G SG GPKIEEVD
Sbjct: 605  ELEGLCNPIIAKMYQGAGADMGGGMDDDAPAA---GGSGAGPKIEEVD 649
  9629.m06146|protein  dnaK protein
            Length = 648
            
 Score = 1209 bits (3094), Expect = 0.0
 Identities = 607/648 (93%), Positives = 626/648 (95%), Gaps = 2/648 (0%)
 Frame = +1

Query: 106  KGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 285
            KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct: 3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA 62

Query: 286  MNPINTVFDAKRLIGRRFSDASVQSDAKLWPFKVIPGPADKPMIGVQYRGEDKQFSAEEI 465
            MNPINTVFDAKRLIGRRFSD SVQSD KLWPFKVIPGP DKPMI VQY+GE+KQFSAEEI
Sbjct: 63   MNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEEI 122

Query: 466  SSMVLNKMKETAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAA 645
            SSMVL KM+E AEAYLG+ IKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEPTAA
Sbjct: 123  SSMVLIKMREIAEAYLGSNIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA 182

Query: 646  AIAYGLDKKSTSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRM 825
            AIAYGLDKK+TS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRM
Sbjct: 183  AIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRM 242

Query: 826  VNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFYTTI 1005
            VNHFV EFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSL+EGIDFY+TI
Sbjct: 243  VNHFVLEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTI 302

Query: 1006 TRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDFFNGK 1185
            TRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIP+VQQLLQDFFNGK
Sbjct: 303  TRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGK 362

Query: 1186 ELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLIPRN 1365
            ELCKSINPDEAVAYGAAVQAAIL+GEGNEKVQDLLLLDVTPLS GLETAGGVMTVLIPRN
Sbjct: 363  ELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRN 422

Query: 1366 TTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVC 1545
            TTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVC
Sbjct: 423  TTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVC 482

Query: 1546 FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVD 1725
            FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYKAEDEEHKKKVD
Sbjct: 483  FDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVD 542

Query: 1726 SKNALENYAYNMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADEFDDKMK 1905
            +KNALENYAYNMRNTIKDDKIASKL   DKKKIEDAI+GAI WLD+NQLAEADEF+DKMK
Sbjct: 543  AKNALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIDGAINWLDSNQLAEADEFEDKMK 602

Query: 1906 ELEGICNPIIAKMYQGAGAEMPG--GMDEDAPASAAGGSSGPGPKIEEVD 2049
            ELE ICNPIIAKMYQGAGA+M G  GMDEDAPA    G SG GPKIEEVD
Sbjct: 603  ELESICNPIIAKMYQGAGADMGGAAGMDEDAPA----GGSGAGPKIEEVD 648
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 161341061 Number of Sequences: 59712 Number of extensions: 5493450 Number of successful extensions: 67808 Number of sequences better than 1.0e-10: 55 Number of HSP's better than 0.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 67429 Number of HSP's gapped (non-prelim): 118 length of query: 743 length of database: 26,991,925 effective HSP length: 53 effective length of query: 689 effective length of database: 23,827,189 effective search space: 16416933221 effective search space used: 16416933221 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 162 (67.5 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG901   Members:91             3pri:Y   1e-131      
CAE01288.1       OSJNBa0020P07.5 [Oryza sativa (japonica
cultivar-group)]
         (2854 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9630.m03028|protein  AF367331 At1g56070/T6H22_13               1645  0.0
 9632.m00189|protein  Elongation factor G, domain IV, putative  1638  0.0
 9629.m05250|protein  Elongation factor G, domain IV, putative  1530  0.0
 9629.m05092|protein  Elongation factor G, domain IV, putative  1377  0.0
 9634.m03897|protein  Elongation factor G, domain IV, putative   619  e-176
 9631.m04330|protein  putative translation elongation factor     308  3e-83
 9630.m03217|protein  Similar to elongation factor EF-2          294  5e-79
 9631.m03522|protein  translation elongation factor G            138  5e-32
 9634.m00447|protein  Similar to GTP-binding membrane prote...   107  9e-23
 9632.m04375|protein  translation elongation factor G            106  3e-22
 9630.m01743|protein  Elongation factor Tu GTP binding doma...   104  1e-21
 9630.m00559|protein  Similar to GTP-binding protein LepA h...   100  2e-20
 9629.m05356|protein  Elongation factor Tu GTP binding doma...    97  1e-19

  9630.m03028|protein  AF367331 At1g56070/T6H22_13
            Length = 843
            
 Score = 1645 bits (4213), Expect = 0.0
 Identities = 806/843 (95%), Positives = 829/843 (97%)
 Frame = +1

Query: 115  MVKFTAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 294
            MVKFT EELR IMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR
Sbjct: 1    MVKFTVEELRRIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 60

Query: 295  ADEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALR 474
            ADEAERGITIKSTGISLFY+M+ ESL++YKG+RDG+EYLINLIDSPGHVDFSSEVTAALR
Sbjct: 61   ADEAERGITIKSTGISLFYEMSDESLKLYKGERDGNEYLINLIDSPGHVDFSSEVTAALR 120

Query: 475  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR 654
            ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR
Sbjct: 121  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR 180

Query: 655  VIENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDEAKM 834
            VIENANVIMATYED LLGDVQVYPEKGTVAFSAGLHGWAFTL++FAKMYASKFGVDE KM
Sbjct: 181  VIENANVIMATYEDTLLGDVQVYPEKGTVAFSAGLHGWAFTLSSFAKMYASKFGVDEFKM 240

Query: 835  MERLWGENFFDPATKKWTSKNTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPMLKK 1014
            MERLWGENFFDPATKKWT+KNTG+ATCKRGFVQFCYEPIKQII TCMNDQKDKLWPML+K
Sbjct: 241  MERLWGENFFDPATKKWTNKNTGSATCKRGFVQFCYEPIKQIINTCMNDQKDKLWPMLQK 300

Query: 1015 LGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGPLD 1194
            LGV MK DEK+LMGKALMKRVMQTWLPAS ALLEMMI+HLPSPSKAQRYRVENLYEGPLD
Sbjct: 301  LGVVMKADEKELMGKALMKRVMQTWLPASNALLEMMIYHLPSPSKAQRYRVENLYEGPLD 360

Query: 1195 DVYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVPGQ 1374
            DVYA AIRNCDP+GPLMLYVSKMIPASDKGRFFAFGRVF+GRVATGMKVRIMGPN+VPGQ
Sbjct: 361  DVYATAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGRVATGMKVRIMGPNYVPGQ 420

Query: 1375 KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEKEVDACPIRA 1554
            KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVA+VGLDQFITKNATLTNEKE DACPIRA
Sbjct: 421  KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVAMVGLDQFITKNATLTNEKESDACPIRA 480

Query: 1555 MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCSIEESGEHIIAGAGELHLEI 1734
            MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLC+IEESGEHIIAGAGELHLEI
Sbjct: 481  MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI 540

Query: 1735 CLKDLQEDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 1914
            CLKDLQEDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE
Sbjct: 541  CLKDLQEDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 600

Query: 1915 AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 2094
            AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI
Sbjct: 601  AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 660

Query: 2095 KDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHTDAIHRGGGQVIPTARRVIYASQLT 2274
            KDSVVAGFQWASKEGALAEENMRGICFEVCDVVLH DAIHRGGGQVIPTARRVIYASQLT
Sbjct: 661  KDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLT 720

Query: 2275 AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFG 2454
            AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFG
Sbjct: 721  AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFG 780

Query: 2455 FSSTLRAATSGQAFPQCVFDHWDIMSSDPLEAGSQSATLVTEIRKRKGLKEQMTPLSDFE 2634
            FSS LRAATSGQAFPQCVFDHWD+M+SDPLEAGSQ++TLV +IRKRKGLKEQMTPLSDFE
Sbjct: 781  FSSQLRAATSGQAFPQCVFDHWDMMTSDPLEAGSQASTLVQDIRKRKGLKEQMTPLSDFE 840

Query: 2635 DKL 2643
            DKL
Sbjct: 841  DKL 843
  9632.m00189|protein  Elongation factor G, domain IV, putative
            Length = 843
            
 Score = 1638 bits (4195), Expect = 0.0
 Identities = 802/843 (95%), Positives = 826/843 (97%)
 Frame = +1

Query: 115  MVKFTAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 294
            MVKFT EELR IMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR
Sbjct: 1    MVKFTVEELRRIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 60

Query: 295  ADEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALR 474
            ADEAERGITIKSTGISLFY+M+ ESL++YKG+RDG+EYLINLIDSPGHVDFSSEVTAALR
Sbjct: 61   ADEAERGITIKSTGISLFYEMSDESLKLYKGERDGNEYLINLIDSPGHVDFSSEVTAALR 120

Query: 475  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR 654
            ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR
Sbjct: 121  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR 180

Query: 655  VIENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDEAKM 834
            VIENANVIMATYED LLGDVQVYPEKGTVAFSAGLHGWAFTL++FAKMYASKFGVDE+KM
Sbjct: 181  VIENANVIMATYEDTLLGDVQVYPEKGTVAFSAGLHGWAFTLSSFAKMYASKFGVDESKM 240

Query: 835  MERLWGENFFDPATKKWTSKNTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPMLKK 1014
            MERLWGENFFDPATKKWT+K+TG+ATCKRGFVQFCYEPIKQII TCMNDQKDKLWPML+K
Sbjct: 241  MERLWGENFFDPATKKWTNKSTGSATCKRGFVQFCYEPIKQIINTCMNDQKDKLWPMLQK 300

Query: 1015 LGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGPLD 1194
            LGV MK DEKDLMGKALMKRVMQTWLPAS ALLEMMI+HLPSPSKAQ+YRVENLYEGPLD
Sbjct: 301  LGVVMKADEKDLMGKALMKRVMQTWLPASNALLEMMIYHLPSPSKAQKYRVENLYEGPLD 360

Query: 1195 DVYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVPGQ 1374
            DVYA AIRNCDP+GPLMLYVSKMIPASDKGRFFAFGRVF+GRVATGMKVRIMGPN+VPGQ
Sbjct: 361  DVYATAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGRVATGMKVRIMGPNYVPGQ 420

Query: 1375 KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEKEVDACPIRA 1554
            KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVA+VGLDQFITKNATLTNEKE DACPIRA
Sbjct: 421  KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVAMVGLDQFITKNATLTNEKEADACPIRA 480

Query: 1555 MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCSIEESGEHIIAGAGELHLEI 1734
            MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLC+IEESGEHIIAGAGELHLEI
Sbjct: 481  MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTIEESGEHIIAGAGELHLEI 540

Query: 1735 CLKDLQEDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 1914
            CLKDLQEDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE
Sbjct: 541  CLKDLQEDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 600

Query: 1915 AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 2094
            AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI
Sbjct: 601  AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 660

Query: 2095 KDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHTDAIHRGGGQVIPTARRVIYASQLT 2274
            KDSVVAGFQWASKEGALAEENMRGICFEVCDVVLH DAIHRGGGQVIPTARRVIYASQLT
Sbjct: 661  KDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLT 720

Query: 2275 AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFG 2454
            AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFG
Sbjct: 721  AKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFG 780

Query: 2455 FSSTLRAATSGQAFPQCVFDHWDIMSSDPLEAGSQSATLVTEIRKRKGLKEQMTPLSDFE 2634
            FSS LRAATSGQAFPQCVFDHWD+M+SDPLE  SQ+  LV +IRKRKGLKEQMTPLSDFE
Sbjct: 781  FSSQLRAATSGQAFPQCVFDHWDMMTSDPLEVSSQANQLVLDIRKRKGLKEQMTPLSDFE 840

Query: 2635 DKL 2643
            DKL
Sbjct: 841  DKL 843
  9629.m05250|protein  Elongation factor G, domain IV, putative
            Length = 826
            
 Score = 1530 bits (3918), Expect = 0.0
 Identities = 746/819 (91%), Positives = 791/819 (96%), Gaps = 2/819 (0%)
 Frame = +1

Query: 115  MVKFTAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 294
            MVKFT EE+R IMDKK+NIRNMSV+AHVDHGKSTLTDSLVAAAGIIAQ+VAGDVRMTD+R
Sbjct: 1    MVKFTVEEMRRIMDKKHNIRNMSVVAHVDHGKSTLTDSLVAAAGIIAQDVAGDVRMTDSR 60

Query: 295  ADEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALR 474
            +DEAERGITIKSTGISL+Y+M+ ESL+ YKGDRDG+EYLINLIDSPGHVDFSSEVTAALR
Sbjct: 61   SDEAERGITIKSTGISLYYEMSDESLKSYKGDRDGNEYLINLIDSPGHVDFSSEVTAALR 120

Query: 475  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR 654
            ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQV GEEAYQTFSR
Sbjct: 121  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVGGEEAYQTFSR 180

Query: 655  VIENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDEAKM 834
            VIENANVIMATYED LLGDVQVYPEKGTVAFSAGLHGWAFTL+NFAKMYASKFGVDE+KM
Sbjct: 181  VIENANVIMATYEDALLGDVQVYPEKGTVAFSAGLHGWAFTLSNFAKMYASKFGVDESKM 240

Query: 835  MERLWGENFFDPATKKWTSKNTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPMLKK 1014
            MERLWGEN+FDP TKKWT K+TG+ TCKRGF+QFCYEPI+QII TCMNDQKDKL PML+K
Sbjct: 241  MERLWGENYFDPTTKKWTIKHTGSDTCKRGFIQFCYEPIRQIINTCMNDQKDKLLPMLQK 300

Query: 1015 LGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGPLD 1194
            LGVTMK    DL GKALMKRVMQTWLPAS ALLEMMI+HLPSP+KAQRYRVENLYEGPLD
Sbjct: 301  LGVTMK----DLTGKALMKRVMQTWLPASNALLEMMIYHLPSPAKAQRYRVENLYEGPLD 356

Query: 1195 DVYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVPGQ 1374
            D+YA+AIRNCDP+GPLMLYVSKMIPASDKGRF+AFGRVF+GRVATGMKVRIMGPN+ PGQ
Sbjct: 357  DIYASAIRNCDPEGPLMLYVSKMIPASDKGRFYAFGRVFSGRVATGMKVRIMGPNYAPGQ 416

Query: 1375 KKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEKEVDACPIRA 1554
            KKDLYVK+VQRTVIWMGKKQESVE VPCGNTVA+VGLDQFITKNATLTNEKEVDACPI+A
Sbjct: 417  KKDLYVKNVQRTVIWMGKKQESVEGVPCGNTVAMVGLDQFITKNATLTNEKEVDACPIKA 476

Query: 1555 MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCSIEESGEHIIAGAGELHLEI 1734
            MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLC++EESGEHIIAGAGELHLEI
Sbjct: 477  MKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCTVEESGEHIIAGAGELHLEI 536

Query: 1735 CLKDLQEDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAE 1914
            CLKDLQEDFMGGAEI VSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARP+EEGL E
Sbjct: 537  CLKDLQEDFMGGAEITVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPMEEGLPE 596

Query: 1915 AIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQYLNEI 2094
            AID+GRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPN+VVDMCKGVQYLNEI
Sbjct: 597  AIDEGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNIVVDMCKGVQYLNEI 656

Query: 2095 KDSVVAGFQWASKEGALAEENM--RGICFEVCDVVLHTDAIHRGGGQVIPTARRVIYASQ 2268
            KDSVVAGFQWASKEGALAEENM  RGICFEVCDV+LH+DAIHRGGGQ+IPTARRVIYA+Q
Sbjct: 657  KDSVVAGFQWASKEGALAEENMRGRGICFEVCDVILHSDAIHRGGGQIIPTARRVIYAAQ 716

Query: 2269 LTAKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIES 2448
            LTAKPRLLEPVYLVEIQAPENALGGIY VLNQKRGHVFEEMQRPGTPLYNIKAYLPVIES
Sbjct: 717  LTAKPRLLEPVYLVEIQAPENALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIES 776

Query: 2449 FGFSSTLRAATSGQAFPQCVFDHWDIMSSDPLEAGSQSATL 2571
            FGF+STLRAATSGQAFP  VFDHW+++S DPLE G++  TL
Sbjct: 777  FGFTSTLRAATSGQAFPLFVFDHWEMLSVDPLEPGTRQLTL 817
  9629.m05092|protein  Elongation factor G, domain IV, putative
            Length = 853
            
 Score = 1377 bits (3525), Expect = 0.0
 Identities = 663/843 (78%), Positives = 753/843 (88%), Gaps = 10/843 (1%)
 Frame = +1

Query: 115  MVKFTAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 294
            MV+FTAEELR  MDKK+NIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQ+VAGDVRMTDTR
Sbjct: 1    MVRFTAEELRASMDKKDNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQDVAGDVRMTDTR 60

Query: 295  ADEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALR 474
            ADEAERGITIKSTGISL+Y+MT  +L  ++G RDG+ YLINLIDSPGH+DFSSEVTAALR
Sbjct: 61   ADEAERGITIKSTGISLYYEMTDAALRSFEGKRDGNSYLINLIDSPGHIDFSSEVTAALR 120

Query: 475  ITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSR 654
            ITDGALVVVDCIEGVCVQTETVLRQ+L ERI+PVLTVNKMDRCFLELQ  GEEAYQ FSR
Sbjct: 121  ITDGALVVVDCIEGVCVQTETVLRQSLAERIKPVLTVNKMDRCFLELQQSGEEAYQAFSR 180

Query: 655  VIENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDEAKM 834
            VIE+ NV MA YED  LGD  V PEKGTVAFSAGLHGWAFTL+NFAKMY +KF VDEAKM
Sbjct: 181  VIESVNVTMAPYEDKNLGDCMVAPEKGTVAFSAGLHGWAFTLSNFAKMYKAKFKVDEAKM 240

Query: 835  MERLWGENFFDPATKKWTSK--NTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPML 1008
            MERLWGEN+FD  TKKWT+   +T + TC+RGFVQFCYEPI++II+ CMND K+ LW ML
Sbjct: 241  MERLWGENYFDHTTKKWTTTAPSTSSKTCQRGFVQFCYEPIRRIISACMNDDKENLWDML 300

Query: 1009 KKLGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGP 1188
             KL +T+K +EK+L GK LMKRVMQ WLPAS ALLEM++FHLPSP+KAQ+YRV+ LY+GP
Sbjct: 301  TKLKITLKAEEKELTGKKLMKRVMQAWLPASDALLEMIVFHLPSPAKAQQYRVDTLYDGP 360

Query: 1189 LDDVYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVP 1368
            LDD YA AIRNCDP GPLM+YVSKMIPASDKGRFFAFGRVF+G VATG KVRIMGPNFVP
Sbjct: 361  LDDPYATAIRNCDPKGPLMVYVSKMIPASDKGRFFAFGRVFSGTVATGNKVRIMGPNFVP 420

Query: 1369 GQKKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEKEVDACPI 1548
            G+KKDLYVK+VQRTVIWMGKKQESV+DVPCGNTVA+VGLDQFITKNATLT+EK VDA PI
Sbjct: 421  GEKKDLYVKTVQRTVIWMGKKQESVDDVPCGNTVAMVGLDQFITKNATLTDEKAVDAHPI 480

Query: 1549 RAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCSIEESGEHIIAGAGELHL 1728
            +AMKFSVSPVVR +V CK AS+LPKLVEGLKRLAKSDP+V+C+IEESGEH+IAG G+LHL
Sbjct: 481  KAMKFSVSPVVRKSVACKNASELPKLVEGLKRLAKSDPLVVCTIEESGEHVIAGVGQLHL 540

Query: 1729 EICLKDLQEDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPL---- 1896
            EIC+KDLQEDFMGGAEIIV PP++++RETV + SCRTVMSKSPNKHNRLYMEARPL    
Sbjct: 541  EICIKDLQEDFMGGAEIIVGPPIITYRETVTKNSCRTVMSKSPNKHNRLYMEARPLDKED 600

Query: 1897 ----EEGLAEAIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDM 2064
                E  L +AIDD RIGP+DD K R KILSEEFGWDKDLAKKIW FGPET GPN++VDM
Sbjct: 601  LQQDEPSLCKAIDDERIGPKDDIKERGKILSEEFGWDKDLAKKIWAFGPETKGPNLLVDM 660

Query: 2065 CKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHTDAIHRGGGQVIPTA 2244
            CKGVQYL+EIKDSVVAGFQWASKEGALAEENMRG+CFE+CDV LH+D+IHRGGGQ+IPTA
Sbjct: 661  CKGVQYLSEIKDSVVAGFQWASKEGALAEENMRGVCFELCDVTLHSDSIHRGGGQLIPTA 720

Query: 2245 RRVIYASQLTAKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIK 2424
            RR +YA+QLTA PRL+EP+Y V+IQ P+ A+G +YGVLN + G + EE +R GTPL N++
Sbjct: 721  RRAMYAAQLTASPRLMEPMYQVDIQVPKTAVGNVYGVLNSRNGELVEESERTGTPLSNLR 780

Query: 2425 AYLPVIESFGFSSTLRAATSGQAFPQCVFDHWDIMSSDPLEAGSQSATLVTEIRKRKGLK 2604
             YLPV +SF F+  LRA TSGQAFPQC+F HW  M SDP + GS++A ++T+IRKRKGLK
Sbjct: 781  FYLPVAKSFDFTEKLRAETSGQAFPQCIFHHWQTMRSDPFQEGSEAAKVITDIRKRKGLK 840

Query: 2605 EQMTPLSDFEDKL 2643
            + +TPLSD+EDKL
Sbjct: 841  DIITPLSDYEDKL 853
  9634.m03897|protein  Elongation factor G, domain IV, putative
            Length = 997
            
 Score =  619 bits (1578), Expect = e-176
 Identities = 327/839 (38%), Positives = 508/839 (59%), Gaps = 22/839 (2%)
 Frame = +1

Query: 127  TAEELRGIMDKKNNIRNMSVIAHVDHGKSTLTDSLVAAAGIIA---QEVAGDVRMTDTRA 297
            T + L G+      +RN++++ H+ HGK+   D LV     +     E    VR TDTR 
Sbjct: 134  TTDFLLGLAANPALVRNVALVGHLQHGKTVFMDMLVEQTHEVDTFDSEGERHVRFTDTRV 193

Query: 298  DEAERGITIKSTGISLFYQMTPESLEMYKGDRDGDEYLINLIDSPGHVDFSSEVTAALRI 477
            DE ER ++IK+  +SL  +             +G  YL N++D+PGHV+FS E+TAALRI
Sbjct: 194  DEQERRVSIKAVPMSLVLE-----------GGNGKSYLCNIMDTPGHVNFSDEMTAALRI 242

Query: 478  TDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVEGEEAYQTFSRV 657
             DGA++VVD  EGV V TE  +R A  ER+  V+ +NK+DR   EL++   +AY      
Sbjct: 243  ADGAVLVVDAAEGVMVNTERAIRHATQERLPIVVVINKVDRLITELKLPPNDAYFKLRHT 302

Query: 658  IENANVIMATYEDVLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGV--DEAK 831
            +E  N ++++    + G   V P  G V F++G  GW+FTL +FA +Y    G+  D  K
Sbjct: 303  LEAINDLISSCSTTVGGTQLVDPAAGNVCFASGSAGWSFTLQSFAHLYLKIHGIQFDHEK 362

Query: 832  MMERLWGENFFDPATKKWTSKNTGTATCKRGFVQFCYEPIKQIIATCMNDQKDKLWPMLK 1011
               RLWG+ ++ P T+ +  K        R FV+F  EP+ +I +  + + K K+   L 
Sbjct: 363  FASRLWGDLYYHPDTRTFKKKPPKEGA-NRSFVEFVLEPLYKIYSQVVGESKGKVEATLS 421

Query: 1012 KLGVTMKNDEKDLMGKALMKRVMQTWLPASRALLEMMIFHLPSPSKAQRYRVENLYEGPL 1191
            +LGVT+ N    L  + L++   ++    S    +M++ H+PS   A   ++E++Y GP 
Sbjct: 422  ELGVTLSNAAYKLNVRPLLRLACRSIFGTSTGFTDMLVKHIPSVKDAAPRKIEHIYTGPQ 481

Query: 1192 DDVYANAIRNCDPDGPLMLYVSKMIPASDKGRFFAFGRVFAGRVATGMKVRIMGPNFVPG 1371
            D    +A++ CDP  PLM+ V+K+ P SD   F AFGRV++G + TG  VR++G  + P 
Sbjct: 482  DSTIVDAMKKCDPHAPLMVNVTKLYPKSDCSVFDAFGRVYSGTIQTGQTVRVLGEGYSPD 541

Query: 1372 QKKDLYVKSVQRTVIWMGKKQESVEDVPCGNTVALVGLDQFITKNATLTNEK-EVDACPI 1548
             ++D+ VK V +  ++  + +  +   P G+ V + G+D  I K AT+   K + D    
Sbjct: 542  DEEDMTVKEVTKLWVYQARYRVPISKAPAGSWVLIEGVDASIMKTATICPMKMDEDVYIF 601

Query: 1549 RAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVLCSIEESGEHIIAGAGELHL 1728
            R ++F+  PVV++A +    S+LPK+VEGL++++KS P+ +  +EESGEH I G GEL+L
Sbjct: 602  RPLRFNTLPVVKIAAEPLNPSELPKMVEGLRKISKSYPLAVTKVEESGEHTILGTGELYL 661

Query: 1729 EICLKDLQEDFMGGAEIIVSPPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGL 1908
            +  +KDL+E +    E+ V+ PVV+F ETV++ S     +++PNK N++ M A PLE+GL
Sbjct: 662  DSIMKDLRELY-SEVEVKVADPVVTFCETVVDTSSMKCFAETPNKRNKITMVAEPLEKGL 720

Query: 1909 AEAIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETTGPNMVVDMCKGVQY-- 2082
            AE I++G +      K  +    + + WD   A+ IW FGPE  GPN+++D    V+   
Sbjct: 721  AEDIENGLVSLDSRQKEITDFFRQRYQWDVLAARSIWAFGPEKQGPNILLDDTLSVEVDK 780

Query: 2083 --LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHTDAIHRGGGQVIPTARRVI 2256
              LN +KDS+V GFQW ++EG L +E +R + F++ +  +  + +HRGGGQ+IPTARRV+
Sbjct: 781  NLLNAVKDSIVQGFQWGAREGPLCDEPIRNVKFKILNANIAPEPLHRGGGQIIPTARRVV 840

Query: 2257 YASQLTAKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIKAYLP 2436
            Y++ L A PRL+EPVY +EIQ P + +  IY VL+++RGHV  ++ +PGTP+Y +KA+LP
Sbjct: 841  YSAFLMANPRLMEPVYYIEIQTPIDCVSAIYTVLSRRRGHVTADVPKPGTPIYVVKAFLP 900

Query: 2437 VIESFGFSSTLRAATSGQAFPQCVFDHWDIMSSDPLEAG------------SQSATLVTE 2580
            VIESFGF + LR  T GQAF   VFDHW I+  DPL+                +   + +
Sbjct: 901  VIESFGFETDLRYHTQGQAFCLSVFDHWAIVPGDPLDKNIVLRPLEPAPIQHLAREFMVK 960

Query: 2581 IRKRKGLKEQMTPLSDFEDKL 2643
             R+RKG+ E ++    F++ +
Sbjct: 961  TRRRKGMSEDVSINKFFDEAM 981
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 174963476 Number of Sequences: 59712 Number of extensions: 4736758 Number of successful extensions: 15014 Number of sequences better than 1.0e-10: 26 Number of HSP's better than 0.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 14964 Number of HSP's gapped (non-prelim): 27 length of query: 951 length of database: 26,991,925 effective HSP length: 54 effective length of query: 896 effective length of database: 23,767,477 effective search space: 21295659392 effective search space used: 21295659392 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 163 (67.9 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG912   Members:130            3pri:Y   .013        
AAG44702.1       mitogaligin [Homo sapiens]
         (1344 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9633.m00193|protein  expressed protein                          257  2e-68
 9633.m00192|protein  expressed protein                          257  2e-68
 9631.m05954|protein expressed protein                           169  1e-41
 9633.m00191|protein  expressed protein                          162  9e-40
 9629.m00559|protein  expressed protein                           98  5e-20
 9638.m02717|protein  transposon protein, putative, CACTA, ...    92  3e-18
 9634.m00954|protein  transposon protein, putative, CACTA, ...    86  1e-16
 9629.m06994|protein  XYPPX repeat, putative                      86  1e-16
 9640.m01344|protein  transposon protein, putative, CACTA, ...    86  2e-16
 9630.m01170|protein  RNA recognition motif. (a.k.a. RRM, R...    84  6e-16
 9638.m02704|protein  transposon protein, putative, CACTA, ...    82  2e-15
 9635.m03213|protein  transposon protein, putative, CACTA, ...    82  3e-15
 9634.m05009|protein  transposon protein, putative, CACTA, ...    80  1e-14
 9634.m01059|protein  transposon protein, putative, CACTA, ...    79  2e-14
 9635.m04941|protein  transposon protein, putative, CACTA, ...    78  3e-14
 9638.m02715|protein  transposon protein, putative, CACTA, ...    77  6e-14
 9635.m02477|protein  transposon protein, putative, CACTA, ...    75  2e-13
 9635.m04045|protein  transposon protein, putative, CACTA, ...    75  4e-13
 9635.m03216|protein  transposon protein, putative, CACTA, ...    75  4e-13
 9629.m00792|protein  transposon protein, putative, CACTA, ...    74  5e-13

  9633.m00193|protein  expressed protein
            Length = 197
            
 Score =  257 bits (651), Expect = 2e-68
 Identities = 145/238 (60%), Positives = 145/238 (60%), Gaps = 4/238 (1%)
 Frame = +3

Query: 327  SRAMGGGNDGHGYPPGGQGGYPPAGYPPQQGGYPPQQGYPPAPGAYPPPPGAYPPAPGAY 506
            S  M G   GHGYPP    GYPP GYPP  G YPP       PGAYPPPPGAYPP PGAY
Sbjct: 17   SNMMHGVAGGHGYPP--HQGYPPQGYPPPPGAYPPP------PGAYPPPPGAYPPPPGAY 68

Query: 507  PPAPGAGGSDGEKGLLSNIMHGVAGAHGGGHGYPSGGHGYPPQQHGYPPQQGYPPQHGYP 686
            PP                            HGYP  G        GYPP  GY PQHG  
Sbjct: 69   PPQ---------------------------HGYPQPG--------GYPPPGGY-PQHG-- 90

Query: 687  PQQHGYPPQQHGYPPAGYPGSSGHSGSHG--GGIGMGGMLAGGAAAAAAAYGAHKISHGG 860
                       GYPPAGYPGSSGH G HG  GG  MG MLAGGAAAAAAAYGAHKIS   
Sbjct: 91   -----------GYPPAGYPGSSGHQGGHGSSGGGHMGAMLAGGAAAAAAAYGAHKIS--S 137

Query: 861  HGGGGHMMGGMMGGHGGYGGGY-GHHGGKFKHGKHG-HGKFKHGKHGKHGMFGGGGKFKK 1034
            HG GGHM  G  GG GGYG GY GHHGGKFKHGKHG HGKFKHGKHG HGMF GGGKFKK
Sbjct: 138  HGHGGHMGYGGHGGFGGYGHGYGGHHGGKFKHGKHGHHGKFKHGKHG-HGMF-GGGKFKK 195

Query: 1035 WK 1040
            WK
Sbjct: 196  WK 197
  9633.m00192|protein  expressed protein
            Length = 197
            
 Score =  257 bits (651), Expect = 2e-68
 Identities = 145/238 (60%), Positives = 145/238 (60%), Gaps = 4/238 (1%)
 Frame = +3

Query: 327  SRAMGGGNDGHGYPPGGQGGYPPAGYPPQQGGYPPQQGYPPAPGAYPPPPGAYPPAPGAY 506
            S  M G   GHGYPP    GYPP GYPP  G YPP       PGAYPPPPGAYPP PGAY
Sbjct: 17   SNMMHGVAGGHGYPP--HQGYPPQGYPPPPGAYPPP------PGAYPPPPGAYPPPPGAY 68

Query: 507  PPAPGAGGSDGEKGLLSNIMHGVAGAHGGGHGYPSGGHGYPPQQHGYPPQQGYPPQHGYP 686
            PP                            HGYP  G        GYPP  GY PQHG  
Sbjct: 69   PPQ---------------------------HGYPQPG--------GYPPPGGY-PQHG-- 90

Query: 687  PQQHGYPPQQHGYPPAGYPGSSGHSGSHG--GGIGMGGMLAGGAAAAAAAYGAHKISHGG 860
                       GYPPAGYPGSSGH G HG  GG  MG MLAGGAAAAAAAYGAHKIS   
Sbjct: 91   -----------GYPPAGYPGSSGHQGGHGSSGGGHMGAMLAGGAAAAAAAYGAHKIS--S 137

Query: 861  HGGGGHMMGGMMGGHGGYGGGY-GHHGGKFKHGKHG-HGKFKHGKHGKHGMFGGGGKFKK 1034
            HG GGHM  G  GG GGYG GY GHHGGKFKHGKHG HGKFKHGKHG HGMF GGGKFKK
Sbjct: 138  HGHGGHMGYGGHGGFGGYGHGYGGHHGGKFKHGKHGHHGKFKHGKHG-HGMF-GGGKFKK 195

Query: 1035 WK 1040
            WK
Sbjct: 196  WK 197
  9631.m05954|protein expressed protein
            Length = 180
            
 Score =  169 bits (423), Expect = 1e-41
 Identities = 115/235 (48%), Positives = 123/235 (51%), Gaps = 9/235 (3%)
 Frame = +3

Query: 336  MGGGNDGHGYPPGGQG--GYPPAGYPPQQGGYPPQQGYPPAPGAYPPPPGAYPPA-PGAY 506
            MGG  D H      +G  G  P+GYP   G YP  QGYP +PG Y P PG YP A PG Y
Sbjct: 1    MGGRKDNHDSSNADKGFHGAYPSGYP---GAYPLMQGYPNSPGQY-PTPGGYPSAPPGQY 56

Query: 507  PPAPGAGGSDGEKGLLSNIMHGVAGAHGGGHGYPSGGHGYPPQQHGYPPQQGYPPQHGYP 686
            PPA                            GYP  G  YPP   GYPP QG  P   YP
Sbjct: 57   PPA---------------------------GGYP--GAQYPPS--GYPPSQGGYPPGAYP 85

Query: 687  PQQHGYPPQQHGYPPAGYPGSSGH-----SGSHGGGI-GMGGMLAGGAAAAAAAYGAHKI 848
            P   GY PQQ GYPPAGYPG  GH      G HG G  G G +LAGGAA AAAA GAH +
Sbjct: 86   PS--GY-PQQPGYPPAGYPG-HGHGPPMQGGGHGAGASGYGALLAGGAAVAAAAVGAHMV 141

Query: 849  SHGGHGGGGHMMGGMMGGHGGYGGGYGHHGGKFKHGKHGHGKFKHGKHGKHGMFGGGGKF 1028
              G  GGGGH             G +GHHGGKFK      GKFKHGK+GKH  FG     
Sbjct: 142  RPG--GGGGH-------------GMFGHHGGKFK-----KGKFKHGKYGKHKKFG----- 176

Query: 1029 KKWK 1040
            +KWK
Sbjct: 177  RKWK 180
  9633.m00191|protein  expressed protein
            Length = 170
            
 Score =  162 bits (407), Expect = 9e-40
 Identities = 101/164 (61%), Positives = 110/164 (66%), Gaps = 9/164 (5%)
 Frame = +3

Query: 525  GGSDGE---KGLLSNIMHGVAGAHGGGHGYPSGGHGYPPQQHGYPPQQGYPPQHGYPPQQ 695
            GGS  E   +GL SN+MHGVAG  GGGHGYP     YPPQQ  YPP    PP    PP  
Sbjct: 2    GGSKDEQQDRGLFSNLMHGVAGG-GGGHGYP-----YPPQQGYYPP----PPTAYPPPPP 51

Query: 696  HGYPPQQHGYPPAGYPGSSG--HSGSHGGGIGMGGMLAGGAAAAAAAYGAHKISHGGHGG 869
             GY    +GYPPAGYPGSS     G+HGG  G  GMLA GAAAAAAAYGAHK+SH GHG 
Sbjct: 52   AGY-GGGYGYPPAGYPGSSAPFQHGNHGG--GNMGMLAAGAAAAAAAYGAHKLSH-GHGH 107

Query: 870  GGHMMGGMMGGHGGYGGGYGHHGGKF--KHGKHGHGKF--KHGKHGKHGMFGG 1016
            GG+  GG  GG   +GG +GHHGG F   HG HG G F   HG HG  G+FGG
Sbjct: 108  GGYGYGGHHGGL--FGGHHGHHGGLFGGHHGHHGGGLFGGHHGHHG--GLFGG 156
 Score = 96.7 bits (237), Expect = 8e-20
 Identities = 75/201 (37%), Positives = 88/201 (43%), Gaps = 13/201 (6%)
 Frame = +3

Query: 336 MGGGNDGHGYPPGGQGGYPPAGYPPQQGGYPPQQG-YPPAPGAYPPPPGA-------YPP 491
           + GG  GHGYP                  YPPQQG YPP P AYPPPP A       YPP
Sbjct: 21  VAGGGGGHGYP------------------YPPQQGYYPPPPTAYPPPPPAGYGGGYGYPP 62

Query: 492 A--PGAYPPAPGAGGSDGEKGLLSNIMHGVA---GAHGGGHGYPSGGHGYPPQQHGYPPQ 656
           A  PG+  P        G  G+L+      A   GAH   HG+  GG+GY     G    
Sbjct: 63  AGYPGSSAPFQHGNHGGGNMGMLAAGAAAAAAAYGAHKLSHGHGHGGYGYGGHHGGL--- 119

Query: 657 QGYPPQHGYPPQQHGYPPQQHGYPPAGYPGSSGHSGSHGGGIGMGGMLAGGAAAAAAAYG 836
             +   HG+    HG           G  G  GH G HGGG+                +G
Sbjct: 120 --FGGHHGH----HG-----------GLFG--GHHGHHGGGL----------------FG 144

Query: 837 AHKISHGGHGGGGHMMGGMMGGHGGYGGGYGHHG 938
            H   HG H       GG+ GGH G+GG +GHHG
Sbjct: 145 GH---HGHH-------GGLFGGHHGFGGHHGHHG 168
  9629.m00559|protein  expressed protein
           Length = 124
           
 Score = 97.5 bits (239), Expect = 5e-20
 Identities = 62/154 (40%), Positives = 70/154 (45%), Gaps = 5/154 (3%)
 Frame = +3

Query: 519 GAGGSDGEKGLLSNIMHGVA--GAHGGGHGYPS--GGHGYPPQQHGYPPQQGYPPQHG-Y 683
           G G + G KGL+S ++ G    G HGGGHGY    GGHGYPP  H       YPPQHG Y
Sbjct: 9   GGGQNGGVKGLVSKLVGGGGHGGGHGGGHGYEQGYGGHGYPP--HAGAAHGAYPPQHGAY 66

Query: 684 PPQQHGYPPQQHGYPPAGYPGSSGHSGSHGGGIGMGGMLAGGAAAAAAAYGAHKISHGGH 863
           PPQ   YP   HGY P  YP ++   G H G                         H GH
Sbjct: 67  PPQHGAYP--GHGYVPGAYPSNAAPHGGHMGSY-----------------------HTGH 101

Query: 864 GGGGHMMGGMMGGHGGYGGGYGHHGGKFKHGKHGHGKFK 980
           GGGG                  H+GGK K G  G GK+K
Sbjct: 102 GGGGGR----------------HYGGKHKGGMFGGGKWK 124
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 114351757 Number of Sequences: 59712 Number of extensions: 4980823 Number of successful extensions: 105700 Number of sequences better than 1.0e-10: 59 Number of HSP's better than 0.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 37 Number of HSP's that attempted gapping in prelim test: 97160 Number of HSP's gapped (non-prelim): 1654 length of query: 448 length of database: 26,991,925 effective HSP length: 52 effective length of query: 395 effective length of database: 23,886,901 effective search space: 9435325895 effective search space used: 9435325895 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG917   Members:354            3pri:Y   1e-116      
P12783           Phosphoglycerate kinase, cytosolic pir||TVWTGY
phosphoglycerate kinase (EC 2.7.2.3), cytosolic - wheat
         (1645 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9634.m04442|protein  phosphoglycerate kinase                    723  0.0
 9630.m00672|protein  phosphoglycerate kinase                    721  0.0
 9630.m00671|protein  phosphoglycerate kinase                    721  0.0
 9633.m03904|protein  phosphoglycerate kinase (EC 2.7.2.3) ...   656  0.0
 9630.m00670|protein  phosphoglycerate kinase                    615  e-176
 9629.m05751|protein  phosphoglycerate kinase                    436  e-122
 9638.m02624|protein  phosphoglycerate kinase, putative          156  1e-37

  9634.m04442|protein  phosphoglycerate kinase
            Length = 401
            
 Score =  723 bits (1847), Expect = 0.0
 Identities = 364/401 (90%), Positives = 389/401 (96%)
 Frame = +2

Query: 113  MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVI 292
            MA+KRSVGTL E+DLKGKKVF+RADLNVPLDD+QKITDDTRIRAS+PTIK+L+ KGAKVI
Sbjct: 1    MASKRSVGTLTESDLKGKKVFLRADLNVPLDDSQKITDDTRIRASVPTIKFLMGKGAKVI 60

Query: 293  LASHLGRPKGVTPKFSLKPLVPRLSELLGLEVVMAPDCIGQEVEKLAAALPDGGVLLLEN 472
            LASHLGRPKGVTPK+SLKPLVPRLSELLG++VVMA DCIG+EV+KLAA LPDGGVLLLEN
Sbjct: 61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVQKLAATLPDGGVLLLEN 120

Query: 473  VRFYKEEEKNEPEFAKKLASVADLYVNDAFGTAHRAHASTEGVTKFLRPSVAGFLMQKEL 652
            VRFYKEEEKN+PEFA KLASVADLYVNDAFGTAHRAHASTEGVTK+LRPSVAGFLMQKEL
Sbjct: 121  VRFYKEEEKNDPEFANKLASVADLYVNDAFGTAHRAHASTEGVTKYLRPSVAGFLMQKEL 180

Query: 653  DYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLAKVDILILGGGMIFTFYKAQGLAVGK 832
            DYLVGAVANPKKPFAAIVGGSKVS+KIGVIESLLAKVDILILGGGMI+TFYKAQG AVGK
Sbjct: 181  DYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDILILGGGMIYTFYKAQGYAVGK 240

Query: 833  SLVEEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAESKIVPATAIPDGWMGLDV 1012
            SLVEEDKLELATSLIE AKSKGV LLLPTD+VVADKFAADAESK VPA+AIPDGWMGLD+
Sbjct: 241  SLVEEDKLELATSLIEKAKSKGVSLLLPTDIVVADKFAADAESKTVPASAIPDGWMGLDI 300

Query: 1013 GPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAIAKQLAELTGKGVTTIIGGGDS 1192
            GPDSIKTF+E LDTTKTVIWNGPMGVFEFEKFAAGTDAIAK+LA++T KGVTTIIGGGDS
Sbjct: 301  GPDSIKTFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAIAKKLADITAKGVTTIIGGGDS 360

Query: 1193 VAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDEA 1315
            VAAVEKAGLADKMSHISTGGGASLELLEGK LPGVLAL++A
Sbjct: 361  VAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALNDA 401
  9630.m00672|protein  phosphoglycerate kinase
            Length = 402
            
 Score =  721 bits (1841), Expect = 0.0
 Identities = 367/401 (91%), Positives = 389/401 (96%), Gaps = 1/401 (0%)
 Frame = +2

Query: 113  MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVI 292
            MATKRSVGTLGEADL+GKKVFVRADLNVPLDDAQKITDDTRIRAS+PT+K+LLEKGAKVI
Sbjct: 1    MATKRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVI 60

Query: 293  LASHLGRPKGVTPKFSLKPLVPRLSELLGLEVVMAPDCIGQEVEKLAAALPDGGVLLLEN 472
            LASHLGRPKGVTPK+SLKPLVPRLSELLG++VVMA DCIG+EVEKLAAALP+GGVLLLEN
Sbjct: 61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLEN 120

Query: 473  VRFYKEEEKNEPEFAKKLASVADLYVNDAFGTAHRAHASTEGVTKFLRPSVAGFLMQKEL 652
            VRFYKEEEKN+PEFAKKLA+VADLYVNDAFGTAHRAHASTEGVTKFL+P+VAGFLMQKEL
Sbjct: 121  VRFYKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHASTEGVTKFLKPAVAGFLMQKEL 180

Query: 653  DYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLAKVDILILGGGMIFTFYKAQGLAVGK 832
            DYLVGAVANPKKPFAAIVGGSKVS+KIGVIESLLAKVD+LILGGGMIFTFYKAQG AVGK
Sbjct: 181  DYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDVLILGGGMIFTFYKAQGYAVGK 240

Query: 833  SLVEEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAESKIVPATAIPDGWMGLDV 1012
            SLVEEDKLELATSLIE AK+KGV LLLPTDVVVADKFAADAESK V A+AIPDGWMGLDV
Sbjct: 241  SLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASAIPDGWMGLDV 300

Query: 1013 GPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAIAKQLAEL-TGKGVTTIIGGGD 1189
            GPD+IKT +EALDT  T+IWNGPMGVFEFEKFAAGTDAIAK+LA+L T KG TTIIGGGD
Sbjct: 301  GPDAIKTSSEALDTCNTIIWNGPMGVFEFEKFAAGTDAIAKKLADLTTTKGATTIIGGGD 360

Query: 1190 SVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDEA 1315
            SVAAVEKAGLADKMSHISTGGGASLELLEGK LPGVLALDEA
Sbjct: 361  SVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA 402
  9630.m00671|protein  phosphoglycerate kinase
            Length = 402
            
 Score =  721 bits (1841), Expect = 0.0
 Identities = 367/401 (91%), Positives = 389/401 (96%), Gaps = 1/401 (0%)
 Frame = +2

Query: 113  MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVI 292
            MATKRSVGTLGEADL+GKKVFVRADLNVPLDDAQKITDDTRIRAS+PT+K+LLEKGAKVI
Sbjct: 1    MATKRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVI 60

Query: 293  LASHLGRPKGVTPKFSLKPLVPRLSELLGLEVVMAPDCIGQEVEKLAAALPDGGVLLLEN 472
            LASHLGRPKGVTPK+SLKPLVPRLSELLG++VVMA DCIG+EVEKLAAALP+GGVLLLEN
Sbjct: 61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLEN 120

Query: 473  VRFYKEEEKNEPEFAKKLASVADLYVNDAFGTAHRAHASTEGVTKFLRPSVAGFLMQKEL 652
            VRFYKEEEKN+PEFAKKLA+VADLYVNDAFGTAHRAHASTEGVTKFL+P+VAGFLMQKEL
Sbjct: 121  VRFYKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHASTEGVTKFLKPAVAGFLMQKEL 180

Query: 653  DYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLAKVDILILGGGMIFTFYKAQGLAVGK 832
            DYLVGAVANPKKPFAAIVGGSKVS+KIGVIESLLAKVD+LILGGGMIFTFYKAQG AVGK
Sbjct: 181  DYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDVLILGGGMIFTFYKAQGYAVGK 240

Query: 833  SLVEEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAESKIVPATAIPDGWMGLDV 1012
            SLVEEDKLELATSLIE AK+KGV LLLPTDVVVADKFAADAESK V A+AIPDGWMGLDV
Sbjct: 241  SLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASAIPDGWMGLDV 300

Query: 1013 GPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAIAKQLAEL-TGKGVTTIIGGGD 1189
            GPD+IKT +EALDT  T+IWNGPMGVFEFEKFAAGTDAIAK+LA+L T KG TTIIGGGD
Sbjct: 301  GPDAIKTSSEALDTCNTIIWNGPMGVFEFEKFAAGTDAIAKKLADLTTTKGATTIIGGGD 360

Query: 1190 SVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDEA 1315
            SVAAVEKAGLADKMSHISTGGGASLELLEGK LPGVLALDEA
Sbjct: 361  SVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA 402
  9633.m03904|protein  phosphoglycerate kinase (EC 2.7.2.3) - spinach
            (fragment)
            Length = 487
            
 Score =  656 bits (1675), Expect = 0.0
 Identities = 324/398 (81%), Positives = 367/398 (91%)
 Frame = +2

Query: 122  KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVILAS 301
            K+SVG L  ADL+GK+VFVRADLNVPLDD Q ITDDTR+RA+IPTI+YL++ GAKVIL+S
Sbjct: 82   KKSVGDLTAADLEGKRVFVRADLNVPLDDNQNITDDTRVRAAIPTIQYLIKNGAKVILSS 141

Query: 302  HLGRPKGVTPKFSLKPLVPRLSELLGLEVVMAPDCIGQEVEKLAAALPDGGVLLLENVRF 481
            HLGRPKGVTPKFSL PLVPRLSELLG++V  A D IG +VEKL + LP+G VLLLENVRF
Sbjct: 142  HLGRPKGVTPKFSLAPLVPRLSELLGIQVTKAEDVIGPDVEKLVSELPNGSVLLLENVRF 201

Query: 482  YKEEEKNEPEFAKKLASVADLYVNDAFGTAHRAHASTEGVTKFLRPSVAGFLMQKELDYL 661
            YKEEEKN+PEFAKKLAS+ADLYVNDAFGTAHRAHASTEGVTKFL+PSVAGFL+QKELDYL
Sbjct: 202  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYL 261

Query: 662  VGAVANPKKPFAAIVGGSKVSSKIGVIESLLAKVDILILGGGMIFTFYKAQGLAVGKSLV 841
            VGAV++PK+PFAAIVGGSKVSSKIGVIESLL K DIL+LGGGMIFTFYKAQGL+VG SLV
Sbjct: 262  VGAVSSPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLV 321

Query: 842  EEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAESKIVPATAIPDGWMGLDVGPD 1021
            EEDKLELATSL+  AK KGV LLLP+DV++ADKFA DA S++VPA+AIPDGWMGLD+GPD
Sbjct: 322  EEDKLELATSLLAKAKEKGVSLLLPSDVIIADKFAPDANSQVVPASAIPDGWMGLDIGPD 381

Query: 1022 SIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAIAKQLAELTGKGVTTIIGGGDSVAA 1201
            S+ +F+  L+TT+TVIWNGPMGVFEF+KFA GT+AIAK+LA+L+GKGVTTIIGGGDSVAA
Sbjct: 382  SVASFSSTLETTQTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKGVTTIIGGGDSVAA 441

Query: 1202 VEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDEA 1315
            VEK G+AD MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct: 442  VEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEA 479
  9630.m00670|protein  phosphoglycerate kinase
            Length = 371
            
 Score =  615 bits (1570), Expect = e-176
 Identities = 308/337 (91%), Positives = 328/337 (96%)
 Frame = +2

Query: 113  MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVI 292
            MATKRSVGTLGEADL+GKKVFVRADLNVPLDDAQKITDDTRIRAS+PT+K+LLEKGAKVI
Sbjct: 1    MATKRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVI 60

Query: 293  LASHLGRPKGVTPKFSLKPLVPRLSELLGLEVVMAPDCIGQEVEKLAAALPDGGVLLLEN 472
            LASHLGRPKGVTPK+SLKPLVPRLSELLG++VVMA DCIG+EVEKLAAALP+GGVLLLEN
Sbjct: 61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLEN 120

Query: 473  VRFYKEEEKNEPEFAKKLASVADLYVNDAFGTAHRAHASTEGVTKFLRPSVAGFLMQKEL 652
            VRFYKEEEKN+PEFAKKLA+VADLYVNDAFGTAHRAHASTEGVTKFL+P+VAGFLMQKEL
Sbjct: 121  VRFYKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHASTEGVTKFLKPAVAGFLMQKEL 180

Query: 653  DYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLAKVDILILGGGMIFTFYKAQGLAVGK 832
            DYLVGAVANPKKPFAAIVGGSKVS+KIGVIESLLAKVD+LILGGGMIFTFYKAQG AVGK
Sbjct: 181  DYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDVLILGGGMIFTFYKAQGYAVGK 240

Query: 833  SLVEEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAESKIVPATAIPDGWMGLDV 1012
            SLVEEDKLELATSLIE AK+KGV LLLPTDVVVADKFAADAESK V A+AIPDGWMGLDV
Sbjct: 241  SLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASAIPDGWMGLDV 300

Query: 1013 GPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTD 1123
            GPD+IKT +EALDT  T+IWNGPMGVFEFEKFAAGTD
Sbjct: 301  GPDAIKTSSEALDTCNTIIWNGPMGVFEFEKFAAGTD 337
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 107552228 Number of Sequences: 59712 Number of extensions: 3143736 Number of successful extensions: 20514 Number of sequences better than 1.0e-10: 14 Number of HSP's better than 0.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 20500 Number of HSP's gapped (non-prelim): 9 length of query: 548 length of database: 26,991,925 effective HSP length: 52 effective length of query: 495 effective length of database: 23,886,901 effective search space: 11824015995 effective search space used: 11824015995 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG926   Members:69             3pri:Y   1e-116      
P07369           Chlorophyll A-B binding protein 3C, chloroplast
precursor (LHCII type I CAB-3C) (LHCP)
         (1014 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9629.m03990|protein  Chlorophyll A-B binding protein, puta...   498  e-141
 9629.m05067|protein  Chlorophyll A-B binding protein, puta...   498  e-141
 9637.m01516|protein  chlorophyll a/b-binding protein I pre...   494  e-139
 9631.m03807|protein  chlorophyll a/b binding protein            411  e-114
 9635.m03724|protein  chlorophyll a-b binding protein of lh...   348  8e-96
 9637.m00977|protein  Chlorophyll A-B binding protein, puta...   219  9e-57
 9639.m01284|protein  chlorophyll a/b-binding protein CP26 ...   216  4e-56
 9634.m02114|protein  chlorophyll a/b-binding protein precu...   142  1e-33
 9635.m03882|protein  LHCI-680, photosystem I antenna prote...   138  1e-32
 9630.m05194|protein  light-harvesting complex protein [imp...   129  1e-29
 9630.m00958|protein  chlorophyll a/b-binding protein type ...   127  4e-29
 9637.m02343|protein  AY086461 PSI type II chlorophyll a/b-...   124  3e-28
 9639.m01283|protein  chlorophyll a/b-binding protein CP26 ...   119  9e-27
 9635.m03689|protein  probable chlorophyll a/b-binding prot...   115  2e-25
 9632.m03624|protein  chlorophyll a/b-binding apoprotein CP...    80  5e-15
 9630.m00957|protein  chlorophyll a/b-binding protein type ...    80  8e-15

  9629.m03990|protein  Chlorophyll A-B binding protein, putative
           Length = 261
           
 Score =  498 bits (1269), Expect = e-141
 Identities = 239/266 (89%), Positives = 250/266 (93%)
 Frame = +1

Query: 88  MAATTMSLSSPAFAGKVVKDLPSSSLFGEARVTMRKTAAKAKKVASSSPWYGSDRVLYLG 267
           MAA TM+LSSPA AGK      ++ +FGE R+TMRK+AAK K  AS SPWYG+DRVLYLG
Sbjct: 1   MAAATMALSSPALAGKA-----AAKVFGEGRITMRKSAAKPKPAASGSPWYGADRVLYLG 55

Query: 268 PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA 447
           PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLA
Sbjct: 56  PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLA 115

Query: 448 RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG 627
           RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGG
Sbjct: 116 RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGG 175

Query: 628 PLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEVKNGRLAMFSMFGFFVQAIVTGKGPL 807
           PLGE+VDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPL
Sbjct: 176 PLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 235

Query: 808 ENLADHLADPVNNNAWAFATNFVPGK 885
           ENLADHLADPVNNNAWA+ATNFVPGK
Sbjct: 236 ENLADHLADPVNNNAWAYATNFVPGK 261
  9629.m05067|protein  Chlorophyll A-B binding protein, putative
           Length = 265
           
 Score =  498 bits (1268), Expect = e-141
 Identities = 241/266 (90%), Positives = 254/266 (94%), Gaps = 2/266 (0%)
 Frame = +1

Query: 88  MAATTMSLSSPA-FAGKVVKDLPSSSLFGEARVTMRKTAAKAKKVASS-SPWYGSDRVLY 261
           MAA+TM+LSSPA  AGK V +   + +FGE RVTMRK+AAK K  A+S SPWYG+DRVLY
Sbjct: 1   MAASTMALSSPAALAGKAVAN---AKVFGEGRVTMRKSAAKPKPAAASGSPWYGADRVLY 57

Query: 262 LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL 441
           LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL
Sbjct: 58  LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL 117

Query: 442 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIA 621
           LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIW CQVVLMGAVEGYR+A
Sbjct: 118 LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWGCQVVLMGAVEGYRVA 177

Query: 622 GGPLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEVKNGRLAMFSMFGFFVQAIVTGKG 801
           GGPLGE+VDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKG
Sbjct: 178 GGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 237

Query: 802 PLENLADHLADPVNNNAWAFATNFVPGK 885
           PLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct: 238 PLENLADHLADPVNNNAWAYATNFVPGK 265
  9637.m01516|protein  chlorophyll a/b-binding protein I precursor -
           rice
           Length = 265
           
 Score =  494 bits (1258), Expect = e-139
 Identities = 241/266 (90%), Positives = 250/266 (93%), Gaps = 1/266 (0%)
 Frame = +1

Query: 88  MAATTMSLSSPAFAGKVVKDLPSSSLFGEARVTMRKTAAKAKKVASS-SPWYGSDRVLYL 264
           MAA TM+LSSP  A        SS+LFGEAR+TMRKTAAK K  ASS SPWYG+DRVLYL
Sbjct: 1   MAAATMALSSPVMARAAPST--SSALFGEARITMRKTAAKPKPAASSGSPWYGADRVLYL 58

Query: 265 GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELL 444
           GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL
Sbjct: 59  GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL 118

Query: 445 ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAG 624
           ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAG
Sbjct: 119 ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAG 178

Query: 625 GPLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEVKNGRLAMFSMFGFFVQAIVTGKGP 804
           GPLGE+VDPLYPGG+FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP
Sbjct: 179 GPLGEVVDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 238

Query: 805 LENLADHLADPVNNNAWAFATNFVPGK 885
           LENLADHLADPVNNNAWA+ATNFVPGK
Sbjct: 239 LENLADHLADPVNNNAWAYATNFVPGK 265
  9631.m03807|protein  chlorophyll a/b binding protein
           Length = 263
           
 Score =  411 bits (1045), Expect = e-114
 Identities = 194/236 (82%), Positives = 212/236 (89%)
 Frame = +1

Query: 178 RVTMRKTAAKAKKVASSSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPE 357
           R+TMR+T     K A  S WYG DR  YLGP S + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct: 32  RITMRRTV----KSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE 87

Query: 358 TFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNP 537
           TFA+NRELEVIH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP
Sbjct: 88  TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP 147

Query: 538 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYPGGSFDPLGLADDPEAFAEL 717
           +LVHAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+FDPLGLADDP+ FAEL
Sbjct: 148 NLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAEL 207

Query: 718 KVKEVKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 885
           KVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWA+ATNFVPGK
Sbjct: 208 KVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK 263
  9635.m03724|protein  chlorophyll a-b binding protein of lhcii type
           iii, chloroplastprecursor (cab)
           Length = 266
           
 Score =  348 bits (884), Expect = 8e-96
 Identities = 181/270 (67%), Positives = 201/270 (74%), Gaps = 2/270 (0%)
 Frame = +1

Query: 73  PPSTTMAATTMSLSSPAFAGKVVKDLPSSSLFGEARVTMRKTAAKAKKVASSSPWYGSDR 252
           P S  +AA T  L  P  +   V+D+ +++     R+TM K             WYG DR
Sbjct: 8   PTSRVLAAKTPFLGHPRPSNAPVRDIAAAAT---GRITMSKEL-----------WYGPDR 53

Query: 253 VLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF 432
           V YLGP S + PSYL GEFPGDYGWDTAGLSADPE FA+NR LEVIH RWAMLGALGC+ 
Sbjct: 54  VKYLGPFSAQTPSYLRGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCIT 113

Query: 433 PELLAR-NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEG 609
           PE+L +   V F E VWFKAG+QIFS+GGLDYLGNP+LVHAQSILA+   QVVLMG VEG
Sbjct: 114 PEVLEKWVRVDFKEPVWFKAGAQIFSDGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEG 173

Query: 610 YRIAGGPLGEIVDPLYPGGS-FDPLGLADDPEAFAELKVKEVKNGRLAMFSMFGFFVQAI 786
           YRI G P     + LYPGG  FDPLGLADDP  FAELKVKE+KNGRLAMFSMFGFFVQAI
Sbjct: 174 YRINGLPGVGDGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAI 233

Query: 787 VTGKGPLENLADHLADPVNNNAWAFATNFVPG 882
           VTGKGPLENL DHLADPV NNAW +AT F PG
Sbjct: 234 VTGKGPLENLLDHLADPVANNAWVYATKFTPG 265
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70628728 Number of Sequences: 59712 Number of extensions: 2119095 Number of successful extensions: 9525 Number of sequences better than 1.0e-10: 32 Number of HSP's better than 0.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 9469 Number of HSP's gapped (non-prelim): 20 length of query: 338 length of database: 26,991,925 effective HSP length: 51 effective length of query: 286 effective length of database: 23,946,613 effective search space: 6848731318 effective search space used: 6848731318 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG949   Members:15             3pri:Y   1e-125      
AAB18209.1       chlorophyll a/b-binding protein WCAB precursor
[Triticum aestivum]
         (1151 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9629.m05067|protein  Chlorophyll A-B binding protein, puta...   487  e-137
 9629.m03990|protein  Chlorophyll A-B binding protein, puta...   485  e-137
 9637.m01516|protein  chlorophyll a/b-binding protein I pre...   480  e-135
 9631.m03807|protein  chlorophyll a/b binding protein            410  e-114
 9635.m03724|protein  chlorophyll a-b binding protein of lh...   338  1e-92
 9637.m00977|protein  Chlorophyll A-B binding protein, puta...   217  2e-56
 9639.m01284|protein  chlorophyll a/b-binding protein CP26 ...   214  2e-55
 9634.m02114|protein  chlorophyll a/b-binding protein precu...   139  8e-33
 9635.m03882|protein  LHCI-680, photosystem I antenna prote...   137  3e-32
 9630.m05194|protein  light-harvesting complex protein [imp...   129  7e-30
 9630.m00958|protein  chlorophyll a/b-binding protein type ...   125  1e-28
 9637.m02343|protein  AY086461 PSI type II chlorophyll a/b-...   122  1e-27
 9639.m01283|protein  chlorophyll a/b-binding protein CP26 ...   118  1e-26
 9635.m03689|protein  probable chlorophyll a/b-binding prot...   115  2e-25
 9636.m03389|protein  chlorophyll a/b-binding protein presu...   108  2e-23
 9632.m03624|protein  chlorophyll a/b-binding apoprotein CP...    82  2e-15
 9630.m00957|protein  chlorophyll a/b-binding protein type ...    80  6e-15

  9629.m05067|protein  Chlorophyll A-B binding protein, putative
            Length = 265
            
 Score =  487 bits (1240), Expect = e-137
 Identities = 236/266 (88%), Positives = 250/266 (93%), Gaps = 2/266 (0%)
 Frame = -1

Query: 1112 MAATTTSLSS-STFAGKAVKNVPLSTLFGEARVTMRKTTAKAKQVSSS-SPWYGADRVLY 939
            MAA+T +LSS +  AGKAV N   + +FGE RVTMRK+ AK K  ++S SPWYGADRVLY
Sbjct: 1    MAASTMALSSPAALAGKAVAN---AKVFGEGRVTMRKSAAKPKPAAASGSPWYGADRVLY 57

Query: 938  LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGSIFPEL 759
            LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALG +FPEL
Sbjct: 58   LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL 117

Query: 758  LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIA 579
            LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIW CQVVLMGAVEGYR+A
Sbjct: 118  LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWGCQVVLMGAVEGYRVA 177

Query: 578  GGPLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 399
            GGPLGE+VDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG
Sbjct: 178  GGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 237

Query: 398  PLENLADHIVDPVNNNAWAFATNFVPGK 315
            PLENLADH+ DPVNNNAWA+ATNFVPGK
Sbjct: 238  PLENLADHLADPVNNNAWAYATNFVPGK 265
  9629.m03990|protein  Chlorophyll A-B binding protein, putative
            Length = 261
            
 Score =  485 bits (1235), Expect = e-137
 Identities = 234/266 (87%), Positives = 243/266 (90%)
 Frame = -1

Query: 1112 MAATTTSLSSSTFAGKAVKNVPLSTLFGEARVTMRKTTAKAKQVSSSSPWYGADRVLYLG 933
            MAA T +LSS   AGKA   V     FGE R+TMRK+ AK K  +S SPWYGADRVLYLG
Sbjct: 1    MAAATMALSSPALAGKAAAKV-----FGEGRITMRKSAAKPKPAASGSPWYGADRVLYLG 55

Query: 932  PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGSIFPELLA 753
            PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALG +FPELLA
Sbjct: 56   PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLA 115

Query: 752  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG 573
            RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGG
Sbjct: 116  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGG 175

Query: 572  PLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 393
            PLGE+VDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL
Sbjct: 176  PLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL 235

Query: 392  ENLADHIVDPVNNNAWAFATNFVPGK 315
            ENLADH+ DPVNNNAWA+ATNFVPGK
Sbjct: 236  ENLADHLADPVNNNAWAYATNFVPGK 261
  9637.m01516|protein  chlorophyll a/b-binding protein I precursor -
            rice
            Length = 265
            
 Score =  480 bits (1222), Expect = e-135
 Identities = 235/266 (88%), Positives = 244/266 (91%), Gaps = 1/266 (0%)
 Frame = -1

Query: 1112 MAATTTSLSSSTFAGKAVKNVPLSTLFGEARVTMRKTTAKAKQVSSS-SPWYGADRVLYL 936
            MAA T +LSS   A  A      S LFGEAR+TMRKT AK K  +SS SPWYGADRVLYL
Sbjct: 1    MAAATMALSSPVMARAAPSTS--SALFGEARITMRKTAAKPKPAASSGSPWYGADRVLYL 58

Query: 935  GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGSIFPELL 756
            GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALG +FPELL
Sbjct: 59   GPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL 118

Query: 755  ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAG 576
            ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLMGAVEGYRIAG
Sbjct: 119  ARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAG 178

Query: 575  GPLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 396
            GPLGE+VDPLYPGG+FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP
Sbjct: 179  GPLGEVVDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP 238

Query: 395  LENLADHIVDPVNNNAWAFATNFVPGK 315
            LENLADH+ DPVNNNAWA+ATNFVPGK
Sbjct: 239  LENLADHLADPVNNNAWAYATNFVPGK 265
  9631.m03807|protein  chlorophyll a/b binding protein
            Length = 263
            
 Score =  410 bits (1042), Expect = e-114
 Identities = 200/266 (75%), Positives = 225/266 (84%), Gaps = 2/266 (0%)
 Frame = -1

Query: 1112 MAATTTSLSSSTFAGKAVKNVPLSTLFGEA--RVTMRKTTAKAKQVSSSSPWYGADRVLY 939
            MAA+    ++S F G A +   L    G++  R+TMR+T   A Q    S WYG DR  Y
Sbjct: 1    MAASALHQTTS-FLGTAPRRDELVRRVGDSGGRITMRRTVKSAPQ----SIWYGPDRPKY 55

Query: 938  LGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGSIFPEL 759
            LGP S + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALG +FPE+
Sbjct: 56   LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEI 115

Query: 758  LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIA 579
            L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LVHAQSILAIWA QVVLMG VEGYR+ 
Sbjct: 116  LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVG 175

Query: 578  GGPLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKG 399
            GGPLGE +D +YPGG+FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKG
Sbjct: 176  GGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKG 235

Query: 398  PLENLADHIVDPVNNNAWAFATNFVPGK 315
            P+ENL DH+ DPV NNAWA+ATNFVPGK
Sbjct: 236  PIENLFDHVADPVANNAWAYATNFVPGK 263
  9635.m03724|protein  chlorophyll a-b binding protein of lhcii type
            iii, chloroplastprecursor (cab)
            Length = 266
            
 Score =  338 bits (858), Expect = 1e-92
 Identities = 182/268 (67%), Positives = 200/268 (73%), Gaps = 6/268 (2%)
 Frame = -1

Query: 1121 SSTMAATTTSLSSST-FAGKA-VKNVPLSTLFGEA--RVTMRKTTAKAKQVSSSSPWYGA 954
            S+ MA T+  L++ T F G     N P+  +   A  R+TM K             WYG 
Sbjct: 3    STIMAPTSRVLAAKTPFLGHPRPSNAPVRDIAAAATGRITMSKEL-----------WYGP 51

Query: 953  DRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGS 774
            DRV YLGP S + PSYL GEFPGDYGWDTAGLSADPE FA+NR LEVIH RWAMLGALG 
Sbjct: 52   DRVKYLGPFSAQTPSYLRGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGC 111

Query: 773  IFPELLAR-NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAV 597
            I PE+L +   V F E VWFKAG+QIFS+GGLDYLGNP+LVHAQSILA+   QVVLMG V
Sbjct: 112  ITPEVLEKWVRVDFKEPVWFKAGAQIFSDGGLDYLGNPNLVHAQSILAVLGFQVVLMGLV 171

Query: 596  EGYRIAGGPLGEIVDPLYPGGS-FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQ 420
            EGYRI G P     + LYPGG  FDPLGLADDP  FAELKVKEIKNGRLAMFSMFGFFVQ
Sbjct: 172  EGYRINGLPGVGDGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQ 231

Query: 419  AIVTGKGPLENLADHIVDPVNNNAWAFATNFVPG 318
            AIVTGKGPLENL DH+ DPV NNAW +AT F PG
Sbjct: 232  AIVTGKGPLENLLDHLADPVANNAWVYATKFTPG 265
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73550337 Number of Sequences: 59712 Number of extensions: 2039986 Number of successful extensions: 8763 Number of sequences better than 1.0e-10: 34 Number of HSP's better than 0.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 8708 Number of HSP's gapped (non-prelim): 23 length of query: 383 length of database: 26,991,925 effective HSP length: 51 effective length of query: 332 effective length of database: 23,946,613 effective search space: 7950275516 effective search space used: 7950275516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG953   Members:12             3pri:Y   3e-73       
BAC10375.1       PsbQ domain protein family, putative-like protein
[Oryza sativa (japonica cultivar-group)]
         (859 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9635.m00050|protein  Oxygen evolving enhancer protein 3 (P...   289  4e-78

  9635.m00050|protein  Oxygen evolving enhancer protein 3 (PsbQ)
           Length = 222
           
 Score =  289 bits (732), Expect = 4e-78
 Identities = 152/225 (67%), Positives = 173/225 (76%), Gaps = 3/225 (1%)
 Frame = -2

Query: 813 STYLSSFQAAAAATSGGASTRPRPRPRPRVVT-CHTFEPSGRRSACLSLGLGLATAAVFH 637
           +TYL S    AA  S     RP PR    +V  C T    GRRSACLS+GL  A A +F 
Sbjct: 2   ATYLQSAGLTAATASTSRLLRPTPRRLLLLVAACST---GGRRSACLSVGLAAAAATIFQ 58

Query: 636 TTPARATADGDEEPEPANNGWWLTEFPLPVPKIRNKEINNGETGTRSFVKNGIYMADIGP 457
             PA A  D     EPANNGWWLTEFPLPVPKI NKE+NNGETG+R+FV+NGIY+ADIGP
Sbjct: 59  HHPACAATDD----EPANNGWWLTEFPLPVPKIVNKELNNGETGSRTFVRNGIYIADIGP 114

Query: 456 SFAAHAYRVRSSAFDLLALEDLLGKEA--SNYVNKYLRLKATFIYYDFDKLITAADPDAK 283
           S+AAHAYR+RS+AFDLLALEDLLG  A  +NYV KYLRLK+TF+Y+DFDKLI+AA  D +
Sbjct: 115 SYAAHAYRLRSTAFDLLALEDLLGNNADRANYVTKYLRLKSTFMYFDFDKLISAASDDQR 174

Query: 282 PPLLDLANRLFDSFEKLQAAVTTKDDTDIGSCYADTKLILQEVMTRMA 139
           PPLLDLA RLFDSFE+LQ A  TKDDT IGS YADTK+ILQEVM +MA
Sbjct: 175 PPLLDLATRLFDSFERLQKACGTKDDTQIGSSYADTKIILQEVMAKMA 222
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64234103 Number of Sequences: 59712 Number of extensions: 2191923 Number of successful extensions: 27849 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 27845 Number of HSP's gapped (non-prelim): 1 length of query: 286 length of database: 26,991,925 effective HSP length: 50 effective length of query: 235 effective length of database: 24,006,325 effective search space: 5641486375 effective search space used: 5641486375 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG970   Members:2              3pri:Y   5e-13       
AAK63895.1       Putative proline-rich protein [Oryza sativa]
dbj|BAC11865.1| proline-rich protein 2 [Oryza sativa (japonica cu
         (705 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9638.m00512|protein  expressed protein                          128  9e-30
 9638.m00510|protein  expressed protein                          127  3e-29
 9638.m00513|protein  Similar to proline-rich protein            125  6e-29
 9638.m00511|protein  expressed protein                          124  1e-28
 9638.m00508|protein  expressed protein                          115  9e-26
 9638.m00492|protein  expressed protein                           90  5e-18
 9638.m00495|protein  expressed protein                           89  1e-17
 9638.m00499|protein  proline-rich protein, putative              88  1e-17
 9638.m00501|protein  proline-rich protein, putative              88  1e-17
 9638.m00497|protein  proline-rich protein, putative              87  4e-17
 9638.m00488|protein  expressed protein                           80  3e-15
 9638.m00506|protein  expressed protein                           78  2e-14
 9631.m01353|protein  expressed protein                           74  3e-13
 9631.m01354|protein  expressed protein                           67  3e-11

  9638.m00512|protein  expressed protein
           Length = 229
           
 Score =  128 bits (319), Expect = 9e-30
 Identities = 75/109 (68%), Positives = 86/109 (78%), Gaps = 34/109 (31%)
 Frame = +3

Query: 6   ADCVAQLHSAASNTPCXGQEPSKIVPVSEGTTFGIVAGDKAATPSAASPECASMTLCGPI 185
           +DC+AQLHSA +N PC GQEPSKIVP+SEGT F  +AG K   PSA    CAS T+CGPI
Sbjct: 91  SDCIAQLHSA-NNEPCPGQEPSKIVPMSEGT-FVAIAG-KTHYPSAL---CASATICGPI 144

Query: 186 KKHIMEHFHHKKPVPPKPEPKPQ---------------------------------PHPD 266
           KK I++HF HKKPVPPKPEPKP+                                 P P+
Sbjct: 145 KKKIIDHF-HKKPVPPKPEPKPEPPKPKPEPEHPFLDHIHKKEKHFFDHFHKKPVPPKPE 203

Query: 267 YGPVPKPEPKPQPHPDYH-PVPP 332
             P PKPEPKPQP P+YH P PP
Sbjct: 204 PKPEPKPEPKPQPAPEYHNPSPP 226
  9638.m00510|protein  expressed protein
           Length = 224
           
 Score =  127 bits (315), Expect = 3e-29
 Identities = 75/109 (68%), Positives = 87/109 (79%), Gaps = 30/109 (27%)
 Frame = +3

Query: 6   ADCVAQLHSAASNTPCXGQEPSKIVPVSEGTTFGIVAGDKAATPSAASPECASMTLCGPI 185
           +DC+AQLHSA +N PC GQEPSKIVP+SEGT F  VAG K    SA    CAS+T+CGPI
Sbjct: 91  SDCIAQLHSA-TNEPCPGQEPSKIVPMSEGT-FAAVAG-KTHYRSAL---CASVTICGPI 144

Query: 186 KKHIMEHFHHKKPVPPKPEPKPQ-----PHPDY------------------------GPV 278
           KK I++HFH KKPVPPKPEPKP+     P P++                         P 
Sbjct: 145 KKKIIDHFH-KKPVPPKPEPKPEPPKPKPEPEHPFLDHIHKKEKHFFDHFHKKPVPPKPE 203

Query: 279 PKPEPKPQPHPDYH-PVPP 332
           PKPEPKPQP P+YH P PP
Sbjct: 204 PKPEPKPQPAPEYHNPSPP 222
  9638.m00513|protein  Similar to proline-rich protein
           Length = 229
           
 Score =  125 bits (312), Expect = 6e-29
 Identities = 75/109 (68%), Positives = 85/109 (77%), Gaps = 34/109 (31%)
 Frame = +3

Query: 6   ADCVAQLHSAASNTPCXGQEPSKIVPVSEGTTFGIVAGDKAATPSAASPECASMTLCGPI 185
           +DCVAQLH A +N PC GQEPSKIVP+SEGT F  VAG +   PSA    CAS T+CGPI
Sbjct: 91  SDCVAQLHGA-TNEPCPGQEPSKIVPMSEGT-FIAVAG-QTHYPSAL---CASATICGPI 144

Query: 186 KKHIMEHFHHKKPVPPKPEPKPQ---------------------------------PHPD 266
           KK I++HF HKKPVPPKPEPKP+                                 P P+
Sbjct: 145 KKKIIDHF-HKKPVPPKPEPKPEPPKPKPEPEHPFLDHIHKKEKHFFDHFHKKPVPPKPE 203

Query: 267 YGPVPKPEPKPQPHPDYH-PVPP 332
             P PKPEPKPQP P+YH P PP
Sbjct: 204 PKPEPKPEPKPQPAPEYHNPSPP 226
  9638.m00511|protein  expressed protein
           Length = 229
           
 Score =  124 bits (309), Expect = 1e-28
 Identities = 73/109 (66%), Positives = 86/109 (77%), Gaps = 34/109 (31%)
 Frame = +3

Query: 6   ADCVAQLHSAASNTPCXGQEPSKIVPVSEGTTFGIVAGDKAATPSAASPECASMTLCGPI 185
           +DC+AQLHSA +N PC GQEPSKIVP+SEGT F  VAG K + PSA    CAS T+CGPI
Sbjct: 91  SDCIAQLHSA-TNEPCPGQEPSKIVPLSEGT-FVTVAG-KTSYPSAL---CASATICGPI 144

Query: 186 KKHIMEHFHHKKPVPPKPEPKPQ---------------------------------PHPD 266
           KK I++HF HKKPVPPKP+PKP+                                 P P+
Sbjct: 145 KKKIIDHF-HKKPVPPKPDPKPEPPKPKPEPEHPILDHFHKKEKDFFDHFHKKPVPPKPE 203

Query: 267 YGPVPKPEPKPQPHPDYH-PVPP 332
               PKP+PKPQP P+YH P PP
Sbjct: 204 PKSEPKPQPKPQPAPEYHNPSPP 226
  9638.m00508|protein  expressed protein
           Length = 196
           
 Score =  115 bits (285), Expect = 9e-26
 Identities = 60/107 (56%), Positives = 69/107 (64%), Gaps = 3/107 (2%)
 Frame = +3

Query: 3   GADCVAQLHSAA-SNTPCXGQEPSKIVPVSEGTTFGIVAGDKAATPSAASPECASMTLCG 179
           GADCVAQLHSAA +N  C GQEPS+++ +SE  TF  VAG         SP CAS T+C 
Sbjct: 88  GADCVAQLHSAAHNNAACPGQEPSRVMQLSE-RTFVAVAGKT----HYVSPVCASATICE 142

Query: 180 PIKKHIMEHFHHKKPVP--PKPEPKPQPHPDYGPVPKPEPKPQPHPDYHP 323
           PIKKH  +HFHH KP P  P  +P P+PHPD  P PKP P       YHP
Sbjct: 143 PIKKHFFDHFHHNKPAPAAPSTKPAPKPHPDQPPHPKPTPTYGTPSPYHP 192
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52923971 Number of Sequences: 59712 Number of extensions: 1944438 Number of successful extensions: 45269 Number of sequences better than 1.0e-10: 28 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 13 Number of HSP's that attempted gapping in prelim test: 45059 Number of HSP's gapped (non-prelim): 50 length of query: 235 length of database: 26,991,925 effective HSP length: 50 effective length of query: 184 effective length of database: 24,006,325 effective search space: 4417163800 effective search space used: 4417163800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 157 (65.6 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG975   Members:6              3pri:Y   5e-45       
CAB65536.1       proline-rich protein [Zea mays]
         (993 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9638.m00510|protein  expressed protein                          239  7e-63
 9638.m00512|protein  expressed protein                          238  1e-62
 9638.m00513|protein  Similar to proline-rich protein            236  6e-62
 9638.m00511|protein  expressed protein                          235  1e-61
 9638.m00508|protein  expressed protein                          219  9e-57
 9638.m00499|protein  proline-rich protein, putative             189  5e-48
 9638.m00501|protein  proline-rich protein, putative             189  9e-48
 9638.m00495|protein  expressed protein                          188  2e-47
 9638.m00488|protein  expressed protein                          181  2e-45
 9638.m00492|protein  expressed protein                          178  2e-44
 9638.m00506|protein  expressed protein                          177  3e-44
 9638.m00504|protein  Putative proline-rich protein              162  7e-40
 9631.m01353|protein  expressed protein                          157  2e-38
 9638.m00497|protein  proline-rich protein, putative             152  1e-36
 9631.m01354|protein  expressed protein                          120  4e-27

  9638.m00510|protein  expressed protein
           Length = 224
           
 Score =  239 bits (603), Expect = 7e-63
 Identities = 137/193 (70%), Positives = 155/193 (79%), Gaps = 34/193 (17%)
 Frame = -2

Query: 941 ATRALVL----GVLLAIAVANAEATSVVVGLAKCADCTRKNIKAEETFNGLQVAIKCKNI 774
           A R LVL     VL+A+AV   EA SVVVG AKCADCTRKN+KAE+ F  LQVAIKCKN 
Sbjct: 4   APRGLVLLGVCAVLMAVAVGG-EAASVVVGTAKCADCTRKNMKAEDAFKNLQVAIKCKNG 62

Query: 773 DGQYESKAVGALDTTGAFSVPLATDLHGADCVAQLHSAASNTPCPGQEPSKIVPVSEGTT 594
           +G+YESKA G LD TGAFSVPL  DLH +DC+AQLHSA +N PCPGQEPSKIVP+SEGT 
Sbjct: 63  NGEYESKATGKLDGTGAFSVPLDADLHSSDCIAQLHSA-TNEPCPGQEPSKIVPMSEGT- 120

Query: 593 FGIVAGDKTATPSAASPECASMTLCGPIKKHIMEHFHHKKPVPPKPEPKPQ-----PHPD 429
           F  VAG KT   SA    CAS+T+CGPIKK I++HFH KKPVPPKPEPKP+     P P+
Sbjct: 121 FAAVAG-KTHYRSAL---CASVTICGPIKKKIIDHFH-KKPVPPKPEPKPEPPKPKPEPE 175

Query: 428 Y------------------------GPVPKPEPKPQPHPDYH-PVPP 363
           +                         P PKPEPKPQP P+YH P PP
Sbjct: 176 HPFLDHIHKKEKHFFDHFHKKPVPPKPEPKPEPKPQPAPEYHNPSPP 222
  9638.m00512|protein  expressed protein
           Length = 229
           
 Score =  238 bits (601), Expect = 1e-62
 Identities = 136/193 (70%), Positives = 153/193 (78%), Gaps = 38/193 (19%)
 Frame = -2

Query: 941 ATRALVL----GVLLAIAVANAEATSVVVGLAKCADCTRKNIKAEETFNGLQVAIKCKNI 774
           A R LVL     VL+A+AV   EA SVVVG AKCADCTRKN+KAE+ F  LQVAIKCKN 
Sbjct: 4   APRGLVLLGVCAVLMAVAVGG-EAASVVVGTAKCADCTRKNMKAEDAFKNLQVAIKCKNT 62

Query: 773 DGQYESKAVGALDTTGAFSVPLATDLHGADCVAQLHSAASNTPCPGQEPSKIVPVSEGTT 594
           +G+YESKA G LD TGAFSVPL  DL  +DC+AQLHSA +N PCPGQEPSKIVP+SEGT 
Sbjct: 63  NGEYESKAAGKLDGTGAFSVPLDADLDSSDCIAQLHSA-NNEPCPGQEPSKIVPMSEGT- 120

Query: 593 FGIVAGDKTATPSAASPECASMTLCGPIKKHIMEHFHHKKPVPPKPEPKPQP-------- 438
           F  +AG KT  PSA    CAS T+CGPIKK I++HFH KKPVPPKPEPKP+P        
Sbjct: 121 FVAIAG-KTHYPSAL---CASATICGPIKKKIIDHFH-KKPVPPKPEPKPEPPKPKPEPE 175

Query: 437 -------------------------HPDYGPVPKPEPKPQPHPDYH-PVPP 363
                                     P+  P PKPEPKPQP P+YH P PP
Sbjct: 176 HPFLDHIHKKEKHFFDHFHKKPVPPKPEPKPEPKPEPKPQPAPEYHNPSPP 226
  9638.m00513|protein  Similar to proline-rich protein
           Length = 229
           
 Score =  236 bits (595), Expect = 6e-62
 Identities = 135/193 (69%), Positives = 152/193 (77%), Gaps = 38/193 (19%)
 Frame = -2

Query: 941 ATRALVL----GVLLAIAVANAEATSVVVGLAKCADCTRKNIKAEETFNGLQVAIKCKNI 774
           A R LVL     VL+A+AV   EA SVVVG AKCADCTRKN+KAE+ F  LQVAIKCKN 
Sbjct: 4   APRGLVLLGVCAVLMAVAVGG-EAASVVVGTAKCADCTRKNMKAEDAFKNLQVAIKCKNG 62

Query: 773 DGQYESKAVGALDTTGAFSVPLATDLHGADCVAQLHSAASNTPCPGQEPSKIVPVSEGTT 594
           +G+YESKA G LD TG FS+PL  DLH +DCVAQLH A +N PCPGQEPSKIVP+SEGT 
Sbjct: 63  NGEYESKATGKLDGTGVFSIPLDADLHSSDCVAQLHGA-TNEPCPGQEPSKIVPMSEGT- 120

Query: 593 FGIVAGDKTATPSAASPECASMTLCGPIKKHIMEHFHHKKPVPPKPEPKPQP-------- 438
           F  VAG +T  PSA    CAS T+CGPIKK I++HFH KKPVPPKPEPKP+P        
Sbjct: 121 FIAVAG-QTHYPSAL---CASATICGPIKKKIIDHFH-KKPVPPKPEPKPEPPKPKPEPE 175

Query: 437 -------------------------HPDYGPVPKPEPKPQPHPDYH-PVPP 363
                                     P+  P PKPEPKPQP P+YH P PP
Sbjct: 176 HPFLDHIHKKEKHFFDHFHKKPVPPKPEPKPEPKPEPKPQPAPEYHNPSPP 226
  9638.m00511|protein  expressed protein
           Length = 229
           
 Score =  235 bits (593), Expect = 1e-61
 Identities = 133/193 (68%), Positives = 155/193 (79%), Gaps = 38/193 (19%)
 Frame = -2

Query: 941 ATRALVL----GVLLAIAVANAEATSVVVGLAKCADCTRKNIKAEETFNGLQVAIKCKNI 774
           A R LVL     VL+ +AV+  EA SVV+G AKCADCTRKN+KAE+ F  LQVAIKCKN 
Sbjct: 4   APRGLVLLGVCAVLMVLAVSG-EAASVVIGTAKCADCTRKNMKAEDAFKNLQVAIKCKNG 62

Query: 773 DGQYESKAVGALDTTGAFSVPLATDLHGADCVAQLHSAASNTPCPGQEPSKIVPVSEGTT 594
           +G+YESKA G LD +GAFSVPL TDLH +DC+AQLHS A+N PCPGQEPSKIVP+SEG T
Sbjct: 63  NGEYESKAAGKLDGSGAFSVPLDTDLHSSDCIAQLHS-ATNEPCPGQEPSKIVPLSEG-T 120

Query: 593 FGIVAGDKTATPSAASPECASMTLCGPIKKHIMEHFHHKKPVPPKPEPKPQ--------- 441
           F  VAG KT+ PSA    CAS T+CGPIKK I++HF HKKPVPPKP+PKP+         
Sbjct: 121 FVTVAG-KTSYPSAL---CASATICGPIKKKIIDHF-HKKPVPPKPDPKPEPPKPKPEPE 175

Query: 440 ------------------------PHPDYGPVPKPEPKPQPHPDYH-PVPP 363
                                   P P+    PKP+PKPQP P+YH P PP
Sbjct: 176 HPILDHFHKKEKDFFDHFHKKPVPPKPEPKSEPKPQPKPQPAPEYHNPSPP 226
  9638.m00508|protein  expressed protein
           Length = 196
           
 Score =  219 bits (551), Expect = 9e-57
 Identities = 117/191 (61%), Positives = 133/191 (69%), Gaps = 4/191 (2%)
 Frame = -2

Query: 944 AATRALVLGVLLAIAVANAEATSVVVGLAKCADCTRKNIKAEETFNGLQVAIKCKN-IDG 768
           AA R L L  +L    A+ EA SVVVGLAKC DCTRKN+KA+  F GL+VAIKCKN  DG
Sbjct: 3   AAGRVLALLAVLMAVAAHGEAASVVVGLAKCGDCTRKNMKAKAAFKGLRVAIKCKNGADG 62

Query: 767 QYESKAVGALDTTGAFSVPLATDLHGADCVAQLHSAA-SNTPCPGQEPSKIVPVSEGTTF 591
           +YE+KA G LD  GAF VPLA DL GADCVAQLHSAA +N  CPGQEPS+++ +SE  TF
Sbjct: 63  EYETKAAGKLDGAGAFRVPLAADLRGADCVAQLHSAAHNNAACPGQEPSRVMQLSE-RTF 121

Query: 590 GIVAGDKTATPSAASPECASMTLCGPIKKHIMEHFHHKKPVP--PKPEPKPQPHPDYGPV 417
             VAG KT      SP CAS T+C PIKKH  +HFHH KP P  P  +P P+PHPD  P 
Sbjct: 122 VAVAG-KT---HYVSPVCASATICEPIKKHFFDHFHHNKPAPAAPSTKPAPKPHPDQPPH 177

Query: 416 PKPEPKPQPHPDYHP 372
           PKP P       YHP
Sbjct: 178 PKPTPTYGTPSPYHP 192
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74440686 Number of Sequences: 59712 Number of extensions: 2838438 Number of successful extensions: 73758 Number of sequences better than 1.0e-10: 30 Number of HSP's better than 0.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 73500 Number of HSP's gapped (non-prelim): 66 length of query: 331 length of database: 26,991,925 effective HSP length: 51 effective length of query: 279 effective length of database: 23,946,613 effective search space: 6681105027 effective search space used: 6681105027 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG1075   Members:154            3pri:Y   2e-56      
 S57779           oleosin 2 - barley emb|CAA57995.1| low molecular
weight oleosin [Hordeum vulgare subsp. vulgare]
         (911 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9632.m04449|protein  oleosin 16 kda (ose701). [rice             233  5e-61
 9637.m01283|protein  expressed protein                          142  7e-34
 9633.m04712|protein  protein F27J15.22 [imported] - Arabid...    93  8e-19
 9631.m04795|protein  oleosin                                     90  7e-18
 9634.m02662|protein  hypothetical protein                        69  1e-11

  9632.m04449|protein  oleosin 16 kda (ose701). [rice
           Length = 224
           
 Score =  233 bits (587), Expect = 5e-61
 Identities = 127/159 (79%), Positives = 135/159 (84%)
 Frame = +1

Query: 73  MAAEHHRDRGVLGGGGAFADRSGQGGYGGDHHDQQKQPAMMCALKAATAATAAGSLLVLS 252
           MA +H   RGV+GGGG + DR GQ         Q+KQ  MM ALK  TAATA GS+LVLS
Sbjct: 77  MADQH---RGVIGGGG-YGDRGGQ-------EQQEKQRFMMTALKTVTAATAGGSMLVLS 125

Query: 253 GLILAGTVIALTVATPVLVIFSPVLVPAAIALALMSAGFVTSGGLGVAALSVFSWMYKYL 432
           GLILAGTVIALTVATPVLVIFSPVLVPAAIALALM+AGFVTSGGLGVAALSVFSWMYKYL
Sbjct: 126 GLILAGTVIALTVATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYL 185

Query: 433 TGKHPPGADQLDHAKARLASKARDIKDAAQTRIDQAQGA 549
           TGKHPPGADQLDHAKARLASKARDIK+AAQ RIDQAQ +
Sbjct: 186 TGKHPPGADQLDHAKARLASKARDIKEAAQHRIDQAQAS 224
  9637.m01283|protein  expressed protein
           Length = 158
           
 Score =  142 bits (355), Expect = 7e-34
 Identities = 78/145 (53%), Positives = 104/145 (70%), Gaps = 10/145 (6%)
 Frame = +1

Query: 109 GGGGAFADR-----SGQGGYGGDHHDQQKQP-AMMCALKAATAATAAGSLLVLSGLILAG 270
           GGGGA  +       G  GYG D    Q++P A +   K A AA AAGS+L L+GL   G
Sbjct: 3   GGGGAVGEHYMRVIRGDDGYGDDGGQHQEKPGAAVSVAKGAAAAAAAGSMLALAGLTATG 62

Query: 271 TVIALTVATPVLVIFSPVLVPAAIALALMSAGFVTSGGLGVAALSVFSWMYKYL---TGK 441
           T +AL VATP+LV+FSPVLVPAA A +L++AG  +SG LG AA+ V +WMY+YL   +G+
Sbjct: 63  TALALIVATPLLVLFSPVLVPAAFAASLLAAGLASSGALGAAAVGVLAWMYRYLQSPSGE 122

Query: 442 H-PPGADQLDHAKARLASKARDIKDAAQTRIDQAQ 543
           H P GA +++HA+A L +KA D+ D  Q R+DQA+
Sbjct: 123 HAPAGAGKVEHARALLDAKAHDVGDWVQHRLDQAR 157
  9633.m04712|protein  protein F27J15.22 [imported] - Arabidopsis
           thaliana, putative
           Length = 173
           
 Score = 92.8 bits (227), Expect = 8e-19
 Identities = 42/103 (40%), Positives = 70/103 (67%)
 Frame = +1

Query: 214 TAATAAGSLLVLSGLILAGTVIALTVATPVLVIFSPVLVPAAIALALMSAGFVTSGGLGV 393
           T A +   LL+L+GL L G V+AL    P+ ++ SP+ VP A+AL +++A  +++    V
Sbjct: 54  TLAVSGAVLLLLTGLTLTGAVVALIFLGPIALLTSPIWVPVAVALFVLAAAALSACAFVV 113

Query: 394 AALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKDAAQ 522
            A++  +WMY+Y TG+HP GAD++D+A++R+A  A  +KD A+
Sbjct: 114 VAVAAGTWMYRYFTGRHPVGADRVDYARSRIADTASHVKDYAR 156
  9631.m04795|protein  oleosin
           Length = 172
           
 Score = 89.7 bits (219), Expect = 7e-18
 Identities = 61/138 (44%), Positives = 77/138 (55%), Gaps = 17/138 (12%)
 Frame = +1

Query: 127 ADRSGQGGYGGDHHDQ----------QKQPAMMCALKAATAATAAGSLLVLSGLILAGTV 276
           ADR   G Y      Q          +K P+   AL  AT     G LLVLSGL LA +V
Sbjct: 2   ADRDRAGQYYQQQRGQVGETVKGILPEKAPSASQALTVATLFPLGGLLLVLSGLALAASV 61

Query: 277 IALTVATPVLVIFSPVLVPAAIALALMSAGFVTSGGLGVAALSVFSWMYKYLTGKHPPGA 456
           + L VATPV +IFSPVLVPAA+ + L  AGF+TSG LG+  LS  +++            
Sbjct: 62  VGLAVATPVFLIFSPVLVPAALLIGLAVAGFLTSGALGLGGLSSLTFLANTARQAFQRTP 121

Query: 457 DQLDHAKARLAS-------KARDIKDAAQTRIDQA 540
           D ++ A+ R+A        K      A Q R DQA
Sbjct: 122 DYVEQARRRMAEAAAHAGHKTAQAGHAIQGRADQA 156
  9634.m02662|protein  hypothetical protein
           Length = 157
           
 Score = 68.7 bits (165), Expect = 1e-11
 Identities = 43/101 (42%), Positives = 57/101 (55%), Gaps = 6/101 (5%)
 Frame = +1

Query: 199 ALKAATAATAAGS-LLVLSGLILAGTVIALTVATPVLVIFSPVLVPAAIALALMSAGFVT 375
           AL AA      G+ LLV +G +L  T+  L +A P LV+FSPVL PAA A  + +AG + 
Sbjct: 35  ALAAAALLVPLGAALLVSAGAVLLATLAGLALAAPPLVLFSPVLAPAAAAAVMAAAGLLA 94

Query: 376 SGGLGVAALSVFSWMYKYL-----TGKHPPGADQLDHAKARLASKAR 501
           +G LGVA +S  +W   Y+      G    G    D A AR   +AR
Sbjct: 95  AGALGVAGVSALAWTVGYIRRGGARGSGGGGVAGDDRAAARRREEAR 141
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67074850 Number of Sequences: 59712 Number of extensions: 2312833 Number of successful extensions: 29578 Number of sequences better than 1.0e-10: 10 Number of HSP's better than 0.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 29569 Number of HSP's gapped (non-prelim): 6 length of query: 303 length of database: 26,991,925 effective HSP length: 51 effective length of query: 252 effective length of database: 23,946,613 effective search space: 6034546476 effective search space used: 6034546476 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG1149   Members:3              3pri:N   2e-43      
 BAB67889.1       putative histone H2B [Oryza sativa (japonica
cultivar-group)] dbj|BAB93209.1| putative histone H2B [Oryza sati
         (626 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9636.m03857|protein  histone H2B                                253  2e-67
 9631.m01675|protein  histone H2B                                252  3e-67
 9631.m01674|protein  histone H2B                                252  3e-67
 9629.m06140|protein  histone H2B                                247  1e-65
 9633.m04685|protein  histone H2B                                247  2e-65
 9629.m00489|protein  histone H2B                                245  4e-65
 9629.m00525|protein  histone H2B                                245  5e-65
 9629.m00521|protein  histone H2B                                245  5e-65
 9629.m00527|protein  histone H2B                                244  9e-65
 9629.m00487|protein  histone H2B                                244  9e-65
 9629.m00523|protein  Core histone H2A/H2B/H3/H4, putative       243  2e-64
 9629.m00516|protein  histone H2B                                239  3e-63
 9633.m03580|protein  histone H2B                                159  3e-39
 9629.m02962|protein  Similar to histone H2B                     149  5e-36
 9637.m03406|protein  probable histone H2B - chicken (fragm...   113  3e-25
 9636.m03856|protein  histone H2B-1                               98  1e-20

  9636.m03857|protein  histone H2B
           Length = 150
           
 Score =  253 bits (639), Expect = 2e-67
 Identities = 132/149 (88%), Positives = 137/149 (91%), Gaps = 1/149 (0%)
 Frame = +1

Query: 61  MAPKAEKKPAEKKPAAEEKAEKAPKGEKKPKAEKRLPAAK-EGGGGGSDKKAKKKAKKSV 237
           MAPKAEKKPAEKKPA E+  EKAP   KKPKAEKRLPA+K E GG G  ++ +KKAKKSV
Sbjct: 1   MAPKAEKKPAEKKPAEEKAGEKAPAAGKKPKAEKRLPASKGEKGGEGKKERGRKKAKKSV 60

Query: 238 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAAKLARYNKKPTITSREI 417
           ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLA EAAKLARYNKKPTITSREI
Sbjct: 61  ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAGEAAKLARYNKKPTITSREI 120

Query: 418 QTSVRLVLPGELAKHAVSEGTKAVTKFTSS 507
           QTSVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct: 121 QTSVRLVLPGELAKHAVSEGTKAVTKFTSS 150
  9631.m01675|protein  histone H2B
           Length = 152
           
 Score =  252 bits (638), Expect = 3e-67
 Identities = 135/149 (90%), Positives = 140/149 (93%), Gaps = 4/149 (2%)
 Frame = +1

Query: 61  MAPKAEKKPAEKKPAA--EEKAEKAPKGEKKPKAEKRLPAAKEGG--GGGSDKKAKKKAK 228
           MAPKAEKKPAEKKPAA  E+ AEKAP G KKPKAEKRLPA+K     GG  DKK +KKAK
Sbjct: 1   MAPKAEKKPAEKKPAAGEEKSAEKAPAG-KKPKAEKRLPASKASSKEGGAGDKKGRKKAK 59

Query: 229 KSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAAKLARYNKKPTITS 408
           KSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAA+LARYNKKPTITS
Sbjct: 60  KSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAARLARYNKKPTITS 119

Query: 409 REIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 507
           REIQTSVRLVLPGELAKHAVSEGTKAVTKFTS+
Sbjct: 120 REIQTSVRLVLPGELAKHAVSEGTKAVTKFTSN 152
  9631.m01674|protein  histone H2B
           Length = 152
           
 Score =  252 bits (638), Expect = 3e-67
 Identities = 135/149 (90%), Positives = 140/149 (93%), Gaps = 4/149 (2%)
 Frame = +1

Query: 61  MAPKAEKKPAEKKPAA--EEKAEKAPKGEKKPKAEKRLPAAKEGG--GGGSDKKAKKKAK 228
           MAPKAEKKPAEKKPAA  E+ AEKAP G KKPKAEKRLPA+K     GG  DKK +KKAK
Sbjct: 1   MAPKAEKKPAEKKPAAGEEKSAEKAPAG-KKPKAEKRLPASKASSKEGGAGDKKGRKKAK 59

Query: 229 KSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAAKLARYNKKPTITS 408
           KSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAA+LARYNKKPTITS
Sbjct: 60  KSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAARLARYNKKPTITS 119

Query: 409 REIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 507
           REIQTSVRLVLPGELAKHAVSEGTKAVTKFTS+
Sbjct: 120 REIQTSVRLVLPGELAKHAVSEGTKAVTKFTSN 152
  9629.m06140|protein  histone H2B
           Length = 139
           
 Score =  247 bits (624), Expect = 1e-65
 Identities = 131/149 (87%), Positives = 134/149 (89%)
 Frame = +1

Query: 61  MAPKAEKKPAEKKPAAEEKAEKAPKGEKKPKAEKRLPAAKEGGGGGSDKKAKKKAKKSVE 240
           MAPKAEKKPAEKKP  E       K EKKPKAEKR+P AKEGGG   +KK KKKAKKSVE
Sbjct: 1   MAPKAEKKPAEKKPVEE-------KAEKKPKAEKRVPGAKEGGG---EKKGKKKAKKSVE 50

Query: 241 TYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAAKLARYNKKPTITSREIQ 420
           TYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAA+LARYNKKPTITSREIQ
Sbjct: 51  TYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAARLARYNKKPTITSREIQ 110

Query: 421 TSVRLVLPGELAKHAVSEGTKAVTKFTSS 507
           TSVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct: 111 TSVRLVLPGELAKHAVSEGTKAVTKFTSS 139
  9633.m04685|protein  histone H2B
           Length = 152
           
 Score =  247 bits (623), Expect = 2e-65
 Identities = 134/149 (89%), Positives = 136/149 (90%), Gaps = 3/149 (2%)
 Frame = +1

Query: 61  MAPKAEKKPAEKKPAAEEKA-EKAPKGEKKPKAEKRLPAAK-EGGGGGSDKKA-KKKAKK 231
           MAPKAEKKPA KKPA EE A EKAP   KKPKAEKRLPA K E GG G  KKA +KK KK
Sbjct: 1   MAPKAEKKPAAKKPAEEEPAAEKAPAAGKKPKAEKRLPAGKGEKGGAGEGKKAGRKKGKK 60

Query: 232 SVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAAKLARYNKKPTITSR 411
           SVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLA EAAKLARYNKKPTITSR
Sbjct: 61  SVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAEAAKLARYNKKPTITSR 120

Query: 412 EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 507
           EIQTSVRLVLPGELAKHAVSEGTKAVTKFTS+
Sbjct: 121 EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA 152
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47155110 Number of Sequences: 59712 Number of extensions: 1840593 Number of successful extensions: 94345 Number of sequences better than 1.0e-10: 32 Number of HSP's better than 0.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 94225 Number of HSP's gapped (non-prelim): 46 length of query: 208 length of database: 26,991,925 effective HSP length: 49 effective length of query: 159 effective length of database: 24,066,037 effective search space: 3826499883 effective search space used: 3826499883 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 156 (65.2 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG1178   Members:22             3pri:Y   1e-100     
 AAM47582.1       putative 60S ribosomal protein [Sorghum bicolor]
         (921 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9631.m05345|protein  putative ribosomal protein L13a            403  e-112
 9635.m00089|protein  ribosomal protein L13, putative            369  e-102
 9631.m05342|protein  putative ribosomal protein L13a            241  1e-63
 9639.m02099|protein  retrotransposon protein, putative, un...   106  5e-23

  9631.m05345|protein  putative ribosomal protein L13a
           Length = 206
           
 Score =  403 bits (1025), Expect = e-112
 Identities = 197/206 (95%), Positives = 202/206 (97%)
 Frame = +1

Query: 58  MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL 237
           MVSGSGVCA RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICMSGGLVRQKMKYL
Sbjct: 1   MVSGSGVCAPRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL 60

Query: 238 RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTARGEAALARLKAYEGVPPPYDRT 417
           RFLRKRMNTKPSHGPIHFR+PAKILWRT+RGMIPHKT RGEAALARLKAYEGVPPPYDRT
Sbjct: 61  RFLRKRMNTKPSHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEGVPPPYDRT 120

Query: 418 KRMVIPDALKVLRLQPGHRYCLLGQLSKEVGWNYADTIRELEEKRKEKAKVSYDRRKQLA 597
           KRMVIPDALKVLRLQPGH+YCLLGQLSKEVGWNY DTIRELEEKRKEKAKV+YDRRKQLA
Sbjct: 121 KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTIRELEEKRKEKAKVAYDRRKQLA 180

Query: 598 KLRVKAEKAAEEKLGTQLEILAPIKY 675
           KLRVKAEKAAEEKLG QLEILAPIKY
Sbjct: 181 KLRVKAEKAAEEKLGPQLEILAPIKY 206
  9635.m00089|protein  ribosomal protein L13, putative
           Length = 238
           
 Score =  369 bits (936), Expect = e-102
 Identities = 182/206 (88%), Positives = 200/206 (96%), Gaps = 32/206 (15%)
 Frame = +1

Query: 58  MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL 237
           MVSGSG+C +RVVVDARHHMLGRLAS+VAKELLNGQRVVVVRCEE+C+SGGLVRQKMKYL
Sbjct: 1   MVSGSGLCTRRVVVDARHHMLGRLASLVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL 60

Query: 238 RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTARGEAALARLKAYEGVPPPYDRT 417
           RFLRKRMNTKPSHGPIHFRAP++I WRT+RGMIPHKT RGEAALA LKA++GVPPPYDRT
Sbjct: 61  RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALANLKAFDGVPPPYDRT 120

Query: 418 KRMVIPDALKVLRLQPGHRYCLLGQLSKEVGWNYADTIR--------------------- 534
           KRMV+PDALKVLRLQPGH+YCLLGQLSKEVGWNY DTIR                     
Sbjct: 121 KRMVVPDALKVLRLQPGHKYCLLGQLSKEVGWNYHDTIRVEWDADSVTFPRDILGDIESL 180

Query: 535 -----------ELEEKRKEKAKVSYDRRKQLAKLRVKAEKAAEEKLGTQLEILAPIKY 675
                      ELEEKRKEKAKV+Y+RRKQL +LRVKAEKAAEEKLG+Q++ILAPIKY
Sbjct: 181 ICGTHMCLDPHELEEKRKEKAKVAYERRKQLTRLRVKAEKAAEEKLGSQIDILAPIKY 238
  9631.m05342|protein  putative ribosomal protein L13a
           Length = 172
           
 Score =  241 bits (609), Expect = 1e-63
 Identities = 122/159 (76%), Positives = 127/159 (79%)
 Frame = +1

Query: 58  MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL 237
           MVSGSGVCA RVVVDARHHML RLASI+AKELLNG+RVV                     
Sbjct: 1   MVSGSGVCAPRVVVDARHHMLSRLASIIAKELLNGKRVV--------------------- 39

Query: 238 RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTARGEAALARLKAYEGVPPPYDRT 417
                RMNTKPSHGPIHFR+PAKILWRT+RGMIPHKT RGEAALARLKAYE V PPYDRT
Sbjct: 40  -----RMNTKPSHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEVVTPPYDRT 94

Query: 418 KRMVIPDALKVLRLQPGHRYCLLGQLSKEVGWNYADTIR 534
           KRMVIPDALKVLRLQPGH+YCLLGQLSKEVGWNY DTIR
Sbjct: 95  KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTIR 133
  9639.m02099|protein  retrotransposon protein, putative,
           unclassified
           Length = 512
           
 Score =  106 bits (263), Expect = 5e-23
 Identities = 50/51 (98%), Positives = 51/51 (99%)
 Frame = +1

Query: 352 RGEAALARLKAYEGVPPPYDRTKRMVIPDALKVLRLQPGHRYCLLGQLSKE 504
           RGEAALARLKAYEGVPPPYDRTKRMVIPDALKVLRLQPGH+YCLLGQLSKE
Sbjct: 9   RGEAALARLKAYEGVPPPYDRTKRMVIPDALKVLRLQPGHKYCLLGQLSKE 59
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68870314 Number of Sequences: 59712 Number of extensions: 2471728 Number of successful extensions: 27882 Number of sequences better than 1.0e-10: 8 Number of HSP's better than 0.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 27875 Number of HSP's gapped (non-prelim): 6 length of query: 307 length of database: 26,991,925 effective HSP length: 51 effective length of query: 255 effective length of database: 23,946,613 effective search space: 6106386315 effective search space used: 6106386315 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 158 (66.0 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG1189   Members:24             3pri:Y   4e-51      
 BAC55749.1       P0456B03.14 [Oryza sativa (japonica cultivar-group)]
         (1109 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9636.m03300|protein  expressed protein                          333  4e-91
 9636.m03301|protein  expressed protein                          256  7e-68
 9637.m01974|protein  hypothetical protein                       122  1e-27

  9636.m03300|protein  expressed protein
           Length = 224
           
 Score =  333 bits (844), Expect = 4e-91
 Identities = 176/223 (78%), Positives = 193/223 (85%), Gaps = 4/223 (1%)
 Frame = +3

Query: 30  MAESDAAAG--KMANGEASDDSGRAVEVSGGEDTLPAVLRSFVDGV--RPPPGDGGDPLL 197
           M ESDAAA   K  NGEAS   GR VEV   EDTLP VLRSFVDGV  +   G GG+PLL
Sbjct: 1   MEESDAAAASAKAPNGEASGGGGRPVEV---EDTLPGVLRSFVDGVCSQGGGGGGGEPLL 57

Query: 198 QRLRAASCEAAPRLRDASRNSARDLLAWTKQGSGLRAILVISVGTITLISLTGLLIFMSF 377
           +R+RAASCE APRLR+ASRNSARDLL WT++GSGLRAILVISVGTITLI+LTGLLIFM F
Sbjct: 58  RRIRAASCETAPRLREASRNSARDLLEWTRRGSGLRAILVISVGTITLIALTGLLIFMFF 117

Query: 378 LLVATANAIVVSVLMSLAAAGGFLALFFACLVAVYVGAVSIAIFVISTTVISAIVAAMIA 557
           LLVAT NA+VVSVLMSLAAAGGFLA+FFACLVAVY+G VS+A+FVIS TVISAIV  MIA
Sbjct: 118 LLVATTNAVVVSVLMSLAAAGGFLAMFFACLVAVYIGVVSVAVFVISATVISAIVGVMIA 177

Query: 558 TGWIGFFWTIWFAARKSLDLTKHSIGMTTSAVQSYSASRRVGQKPTD 698
           TGW+GFFW IWFAARKS+DLTKHSIG+T SA+QSYSASR   QKP D
Sbjct: 178 TGWLGFFWMIWFAARKSMDLTKHSIGVTNSAIQSYSASRHAKQKPID 224
  9636.m03301|protein  expressed protein
           Length = 208
           
 Score =  256 bits (646), Expect = 7e-68
 Identities = 141/178 (79%), Positives = 154/178 (86%), Gaps = 4/178 (2%)
 Frame = +3

Query: 30  MAESDAAAG--KMANGEASDDSGRAVEVSGGEDTLPAVLRSFVDGV--RPPPGDGGDPLL 197
           M ESDAAA   K  NGEAS   GR VEV   EDTLP VLRSFVDGV  +   G GG+PLL
Sbjct: 1   MEESDAAAASAKAPNGEASGGGGRPVEV---EDTLPGVLRSFVDGVCSQGGGGGGGEPLL 57

Query: 198 QRLRAASCEAAPRLRDASRNSARDLLAWTKQGSGLRAILVISVGTITLISLTGLLIFMSF 377
           +R+RAASCE APRLR+ASRNSARDLL WT++GSGLRAILVISVGTITLI+LTGLLIFM F
Sbjct: 58  RRIRAASCETAPRLREASRNSARDLLEWTRRGSGLRAILVISVGTITLIALTGLLIFMFF 117

Query: 378 LLVATANAIVVSVLMSLAAAGGFLALFFACLVAVYVGAVSIAIFVISTTVISAIVAAMIA 557
           LLVAT NA+VVSVLMSLAAAGGFLA+FFACLVAVY+G VS+A+FVIS TVISAIV  MIA
Sbjct: 118 LLVATTNAVVVSVLMSLAAAGGFLAMFFACLVAVYIGVVSVAVFVISATVISAIVGVMIA 177

Query: 558 TG 563
           TG
Sbjct: 178 TG 179
  9637.m01974|protein  hypothetical protein
           Length = 143
           
 Score =  122 bits (303), Expect = 1e-27
 Identities = 65/138 (47%), Positives = 87/138 (62%), Gaps = 1/138 (0%)
 Frame = +3

Query: 204 LRAASCEAAPRL-RDASRNSARDLLAWTKQGSGLRAILVISVGTITLISLTGLLIFMSFL 380
           LR  +C    RL RDA   +AR L AWT++G   RA+LV SVG++ L +LT LL+    L
Sbjct: 9   LRGCACADGGRLLRDACHGAARGLAAWTRRGGAARALLVASVGSVALAALTVLLVAAFVL 68

Query: 381 LVATANAIVVSVLMSLAAAGGFLALFFACLVAVYVGAVSIAIFVISTTVISAIVAAMIAT 560
           + A  +A  V+ ++SLAA    LA+        YVGA+S+A+FV++ T  + +VA  IAT
Sbjct: 69  VAAATSAAAVAAVVSLAALSALLAV-------AYVGALSVAVFVVAATTAATVVAITIAT 121

Query: 561 GWIGFFWTIWFAARKSLDL 617
           GW   FW IWFAARK LDL
Sbjct: 122 GWAALFWIIWFAARKCLDL 140
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75189440 Number of Sequences: 59712 Number of extensions: 2364019 Number of successful extensions: 34873 Number of sequences better than 1.0e-10: 6 Number of HSP's better than 0.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 34865 Number of HSP's gapped (non-prelim): 5 length of query: 369 length of database: 26,991,925 effective HSP length: 51 effective length of query: 318 effective length of database: 23,946,613 effective search space: 7615022934 effective search space used: 7615022934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG1192   Members:79             3pri:Y   1e-126     
 Q40677           Fructose-bisphosphate aldolase, chloroplast
precursor (ALDP) pir||T03679 probable fructose-bisphosphate aldola
         (1606 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9639.m00637|protein  Fructose-bisphosphate aldolase class-I     720  0.0
 9639.m00638|protein  Fructose-bisphosphate aldolase class-I     657  0.0
 9629.m00200|protein  Fructose-bisphosphate aldolase class-...   538  e-152
 9629.m06736|protein  Fructose-bisphosphate aldolase class-I     381  e-105
 9636.m00174|protein  Fructose-bisphosphate aldolase class-I     381  e-105
 9634.m03902|protein  Fructose-bisphosphate aldolase class-I     380  e-105
 9633.m03072|protein  Fructose-bisphosphate aldolase class-I     374  e-103
 9640.m00648|protein  Fructose-bisphosphate aldolase class-I     260  2e-80
 9629.m05120|protein  retrotransposon protein, putative, Ty...    73  1e-12
 9639.m04036|protein  transposon protein, putative, CACTA, ...    72  2e-12
 9629.m00408|protein  expressed protein                           68  4e-11
 9637.m00098|protein  Similar to aldolase                         68  6e-11
 9636.m00525|protein  dna-directed rna polymerase ii larges...    67  8e-11

  9639.m00637|protein  Fructose-bisphosphate aldolase class-I
            Length = 388
            
 Score =  720 bits (1838), Expect = 0.0
 Identities = 358/385 (92%), Positives = 371/385 (95%), Gaps = 3/385 (0%)
 Frame = +2

Query: 158  MASATLLKSSFLPKKAEWGVARQVAAPR---VSMVVRAGAYDDELVKTAKTIASPGRGIL 328
            MASATLLKSSFLPKK+EWG  RQ AAP+   VSMVVRAGAYDDELVKTAKTIASPGRGIL
Sbjct: 1    MASATLLKSSFLPKKSEWGATRQAAAPKPVTVSMVVRAGAYDDELVKTAKTIASPGRGIL 60

Query: 329  AMDESNATCGKRLDSIGLENTEANRQAFRTLLVSVPGLGNHISGAILFEETLYQSTVDGK 508
            AMDESNATCGKRL SIGLENTEANRQA+RTLLV+ PGLG +ISGAILFEETLYQSTVDGK
Sbjct: 61   AMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTVDGK 120

Query: 509  KIVDILAEQGIVPGIKVDKGLVPLTGSNDESWCQGLDGLASREAAYYQQGARFAKWRTVV 688
            KIVDIL EQ IVPGIKVDKGLVPL GSN+ESWCQGLDGLASREAAYYQQGARFAKWRTVV
Sbjct: 121  KIVDILTEQKIVPGIKVDKGLVPLAGSNNESWCQGLDGLASREAAYYQQGARFAKWRTVV 180

Query: 689  SIPNGPSELAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIGRTFEVAQKVWAET 868
            SIPNGPSELAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGI RTFEVAQKVWAET
Sbjct: 181  SIPNGPSELAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIDRTFEVAQKVWAET 240

Query: 869  FYQMSQNNVMFEGILLKPSMVTPGAECKDRATPEQVADYTLKLLSRRVPPAVPGIMFLSG 1048
            F+ M++NNVMFEGILLKPSMVTPGAECKDRATPEQV+DYTLKLL RR+PPAVPGIMFLSG
Sbjct: 241  FFYMAENNVMFEGILLKPSMVTPGAECKDRATPEQVSDYTLKLLHRRIPPAVPGIMFLSG 300

Query: 1049 GQSEVEATLNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGRPENVKAAQEALLLRAKAN 1228
            GQSEVEAT NLNAMNQGPNPWHVSFSYARALQNTCLKTWGG+PENVKAAQ+ALLLRAKAN
Sbjct: 301  GQSEVEATQNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGQPENVKAAQDALLLRAKAN 360

Query: 1229 SLAQLGKYTSDGEAAEAKEGMFVKNYSY 1312
            SLAQLGKYTSDGEAAEAKEGMFVKNY Y
Sbjct: 361  SLAQLGKYTSDGEAAEAKEGMFVKNYVY 388
  9639.m00638|protein  Fructose-bisphosphate aldolase class-I
            Length = 363
            
 Score =  657 bits (1676), Expect = 0.0
 Identities = 333/385 (86%), Positives = 346/385 (89%), Gaps = 3/385 (0%)
 Frame = +2

Query: 158  MASATLLKSSFLPKKAEWGVARQVAAPR---VSMVVRAGAYDDELVKTAKTIASPGRGIL 328
            MASATLLKSSFLPKK+EWG  RQ AAP+   VSMVVRAGAYDDELVKTAKTIASPGRGIL
Sbjct: 1    MASATLLKSSFLPKKSEWGATRQAAAPKPVTVSMVVRAGAYDDELVKTAKTIASPGRGIL 60

Query: 329  AMDESNATCGKRLDSIGLENTEANRQAFRTLLVSVPGLGNHISGAILFEETLYQSTVDGK 508
            AMDESNATCGKRL SIGLENTEANRQA+RTLLV+ PGLG +ISGAILFEETLYQSTVDGK
Sbjct: 61   AMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTVDGK 120

Query: 509  KIVDILAEQGIVPGIKVDKGLVPLTGSNDESWCQGLDGLASREAAYYQQGARFAKWRTVV 688
            KIVDIL EQ IVPGIKVDKGLVPL GSN+ESWCQGLDGLASREAAYYQQGARFAKWRTVV
Sbjct: 121  KIVDILTEQKIVPGIKVDKGLVPLAGSNNESWCQGLDGLASREAAYYQQGARFAKWRTVV 180

Query: 689  SIPNGPSELAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIGRTFEVAQKVWAET 868
            SIPNGPSELA                         PEILLDGEHGI RTFEVAQKVWAET
Sbjct: 181  SIPNGPSELA-------------------------PEILLDGEHGIDRTFEVAQKVWAET 215

Query: 869  FYQMSQNNVMFEGILLKPSMVTPGAECKDRATPEQVADYTLKLLSRRVPPAVPGIMFLSG 1048
            F+ M++NNVMFEGILLKPSMVTPGAECKDRATPEQV+DYTLKLL RR+PPAVPGIMFLSG
Sbjct: 216  FFYMAENNVMFEGILLKPSMVTPGAECKDRATPEQVSDYTLKLLHRRIPPAVPGIMFLSG 275

Query: 1049 GQSEVEATLNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGRPENVKAAQEALLLRAKAN 1228
            GQSEVEAT NLNAMNQGPNPWHVSFSYARALQNTCLKTWGG+PENVKAAQ+ALLLRAKAN
Sbjct: 276  GQSEVEATQNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGQPENVKAAQDALLLRAKAN 335

Query: 1229 SLAQLGKYTSDGEAAEAKEGMFVKNYSY 1312
            SLAQLGKYTSDGEAAEAKEGMFVKNY Y
Sbjct: 336  SLAQLGKYTSDGEAAEAKEGMFVKNYVY 363
  9629.m00200|protein  Fructose-bisphosphate aldolase class-I, putative
            Length = 1613
            
 Score =  538 bits (1371), Expect = e-152
 Identities = 274/366 (74%), Positives = 309/366 (83%), Gaps = 4/366 (1%)
 Frame = +2

Query: 194  PKKAEW--GVARQVAAPRVSMVVRAGA--YDDELVKTAKTIASPGRGILAMDESNATCGK 361
            P    W  G  R+ A PR + V+RA A  Y DELV TAK++ASPGRGILA+DESNATCGK
Sbjct: 12   PAATTWLPGGGRRSAPPRRATVIRAAAVSYADELVSTAKSVASPGRGILAIDESNATCGK 71

Query: 362  RLDSIGLENTEANRQAFRTLLVSVPGLGNHISGAILFEETLYQSTVDGKKIVDILAEQGI 541
            RL SIGL+NTE NRQA+R LL++  GLG +ISGAILFEETLYQST DGKK VD L +Q I
Sbjct: 72   RLASIGLDNTEVNRQAYRQLLLTTAGLGEYISGAILFEETLYQSTTDGKKFVDCLKDQNI 131

Query: 542  VPGIKVDKGLVPLTGSNDESWCQGLDGLASREAAYYQQGARFAKWRTVVSIPNGPSELAV 721
            +PGIKVDKGLVPL GSN+ESWCQGLDGLASR              RTVVSIP GPS LAV
Sbjct: 132  MPGIKVDKGLVPLPGSNNESWCQGLDGLASR--------------RTVVSIPCGPSALAV 177

Query: 722  KEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIGRTFEVAQKVWAETFYQMSQNNVMF 901
            KEAAWGLARYAAI+QDNGLVPIVEPEILLDG+H I RT EVA+KVW+E F+ ++QNNV+F
Sbjct: 178  KEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHAIERTLEVAEKVWSEVFFYLAQNNVLF 237

Query: 902  EGILLKPSMVTPGAECKDRATPEQVADYTLKLLSRRVPPAVPGIMFLSGGQSEVEATLNL 1081
            EGILLKPSMVTPGAE K +ATPE +A +TL +L RRVPPAVPGIMFLSGGQSEVEATLNL
Sbjct: 238  EGILLKPSMVTPGAEHKQKATPEAIAKHTLTMLRRRVPPAVPGIMFLSGGQSEVEATLNL 297

Query: 1082 NAMNQGPNPWHVSFSYARALQNTCLKTWGGRPENVKAAQEALLLRAKANSLAQLGKYTSD 1261
            NAMNQ PNPWHVSFSYARALQN+ LKTW GRPENV+AAQ+ALL+RAKANSLAQLG+YT +
Sbjct: 298  NAMNQEPNPWHVSFSYARALQNSVLKTWQGRPENVEAAQKALLVRAKANSLAQLGRYTGE 357

Query: 1262 GEAAEAKEGM 1291
            GE+ EAK+G+
Sbjct: 358  GESDEAKKGI 367
  9629.m06736|protein  Fructose-bisphosphate aldolase class-I
            Length = 358
            
 Score =  381 bits (969), Expect = e-105
 Identities = 200/355 (56%), Positives = 249/355 (69%), Gaps = 4/355 (1%)
 Frame = +2

Query: 248  MVVRAGAYDDELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAFRTLLV 427
            M    G Y DEL+K A  I +PG+GILA DES  T GKR  SI +EN E NR++ R LL 
Sbjct: 1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLF 60

Query: 428  SVPGLGNHISGAILFEETLYQSTVDGKKIVDILAEQGIVPGIKVDKGLVPLTGSNDESWC 607
            + PG   H+SG ILFEETLYQ T DGK  VD+L E G++PGIKVDKG V + G+N E+  
Sbjct: 61   TTPGALQHLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTVEVAGTNKETTT 120

Query: 608  QGLDGLASREAAYYQQGARFAKWRTVVSI-PNGPSELAVKEAAWGLARYAAISQDNGLVP 784
            QG D L  R A YY+ GARFAKWR V+ I PN PS+L++   A GLARYA I Q+NGLVP
Sbjct: 121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLSIDLNAQGLARYAIICQENGLVP 180

Query: 785  IVEPEILLDGEHGIGRTFEVAQKVWAETFYQMSQNNVMFEGILLKPSMVTPGAECKDRAT 964
            IVEPEIL+DG H I R   V +KV A  +  +++++V+ EG LLKP+MVTPG+E K + +
Sbjct: 181  IVEPEILVDGSHDIERCAYVTEKVLAACYKALNEHHVLLEGSLLKPNMVTPGSESK-KVS 239

Query: 965  PEQVADYTLKLLSRRVPPAVPGIMFLSGGQSEVEATLNLNAMNQ--GPNPWHVSFSYARA 1138
            P+ +A+YT++ L R VP AVP I+FLSGGQSE EAT+NLNAMN+     PW +SFS+ RA
Sbjct: 240  PQLIAEYTVRALQRTVPAAVPAIVFLSGGQSEEEATVNLNAMNKLSTKKPWALSFSFGRA 299

Query: 1139 LQNTCLKTWGGRPENVKAAQEALLLRAKANSLAQLGKYTSDGEAAE-AKEGMFVKNYSY 1312
            LQ + LK WGG+ ENV  AQ+A + R KANS A LG Y  D    E A E + VK+Y Y
Sbjct: 300  LQQSTLKAWGGKTENVVKAQKAFITRCKANSEATLGTYQGDAVLGEGASESLHVKDYKY 358
  9636.m00174|protein  Fructose-bisphosphate aldolase class-I
            Length = 362
            
 Score =  381 bits (967), Expect = e-105
 Identities = 206/355 (58%), Positives = 249/355 (70%), Gaps = 8/355 (2%)
 Frame = +2

Query: 248  MVVRAGAYDDELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAFRTLLV 427
            M    G Y DEL++ A  I +PG+GILA DES  T GKRL SIG+EN E NR+A R LL 
Sbjct: 1    MSAYCGKYKDELIRNAAYIGTPGKGILAADESTGTIGKRLASIGVENVEENRRALRELLF 60

Query: 428  SVPGLGNHISGAILFEETLYQSTVDGKKIVDILAEQGIVPGIKVDKGLVPLTGSNDESWC 607
            + PG  + +SG ILFEETLYQST DG   VD+LA  G++ GIKVDKG V L G++ E+  
Sbjct: 61   TAPGALDCLSGVILFEETLYQSTRDGTPFVDVLAAAGVLAGIKVDKGTVELAGTDRETTT 120

Query: 608  QGLDGLASREAAYYQQGARFAKWRTVVSI---PNGPSELAVKEAAWGLARYAAISQDNGL 778
            QG DGL  R   YY  GARFAKWR V+SI    + PS+LAV   A GLARYA I Q+NGL
Sbjct: 121  QGHDGLGERCRRYYAAGARFAKWRAVLSIGRASSRPSQLAVDANAQGLARYAIICQENGL 180

Query: 779  VPIVEPEILLDGEHGIGRTFEVAQKVWAETFYQMSQNNVMFEGILLKPSMVTPGAECKDR 958
            VPIVEPEIL+DGEHGI    EV ++V A  +  +S ++V+ EG LLKP+MVTPG++   R
Sbjct: 181  VPIVEPEILVDGEHGIEACAEVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDAA-R 239

Query: 959  ATPEQVADYTLKLLSRRVPPAVPGIMFLSGGQSEVEATLNLNAMNQ----GPNPWHVSFS 1126
            A PE VA++T++ L R VPPAVP I+FLSGGQSE EAT NLNAMNQ    G  PW ++FS
Sbjct: 240  APPEVVAEHTVRALLRTVPPAVPAIVFLSGGQSEEEATRNLNAMNQVASRGKKPWSLTFS 299

Query: 1127 YARALQNTCLKTWGGRPENVKAAQEALLLRAKANSLAQLGKYTSDGEAAE-AKEGMFVKN 1303
            + RALQ + LK W G+ ENV  AQ ALL R +ANS A LG Y  D  A E   E + VK+
Sbjct: 300  FGRALQQSTLKAWAGKAENVGKAQAALLARCRANSQATLGAYAGDAAAGEGVSENLHVKD 359

Query: 1304 YSY 1312
            Y Y
Sbjct: 360  YKY 362
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 117161087 Number of Sequences: 59712 Number of extensions: 4106008 Number of successful extensions: 58208 Number of sequences better than 1.0e-10: 26 Number of HSP's better than 0.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 57921 Number of HSP's gapped (non-prelim): 68 length of query: 535 length of database: 26,991,925 effective HSP length: 52 effective length of query: 482 effective length of database: 23,886,901 effective search space: 11513486282 effective search space used: 11513486282 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG1198   Members:900            3pri:Y   1e-117     
 Q40677           Fructose-bisphosphate aldolase, chloroplast
precursor (ALDP) pir||T03679 probable fructose-bisphosphate aldola
         (1622 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9639.m00637|protein  Fructose-bisphosphate aldolase class-I     730  0.0
 9639.m00638|protein  Fructose-bisphosphate aldolase class-I     666  0.0
 9629.m00200|protein  Fructose-bisphosphate aldolase class-...   545  e-154
 9634.m03902|protein  Fructose-bisphosphate aldolase class-I     387  e-107
 9629.m06736|protein  Fructose-bisphosphate aldolase class-I     379  e-105
 9636.m00174|protein  Fructose-bisphosphate aldolase class-I     377  e-104
 9633.m03072|protein  Fructose-bisphosphate aldolase class-I     371  e-102
 9640.m00648|protein  Fructose-bisphosphate aldolase class-I     265  2e-70
 9637.m00098|protein  Similar to aldolase                         69  3e-11

  9639.m00637|protein  Fructose-bisphosphate aldolase class-I
            Length = 388
            
 Score =  730 bits (1863), Expect = 0.0
 Identities = 361/388 (93%), Positives = 373/388 (96%)
 Frame = +1

Query: 88   MASATLLKSSFLPKKAEWGATRQAAAPKPMTVSMVVRASAYADELVKTAKTIASPGRGIL 267
            MASATLLKSSFLPKK+EWGATRQAAAPKP+TVSMVVRA AY DELVKTAKTIASPGRGIL
Sbjct: 1    MASATLLKSSFLPKKSEWGATRQAAAPKPVTVSMVVRAGAYDDELVKTAKTIASPGRGIL 60

Query: 268  AMDESNATCGKRLASIGLENTEANRQAYRTLLVTPPGLGNYISGAILFEETLYQSTVDGK 447
            AMDESNATCGKRLASIGLENTEANRQAYRTLLVT PGLG YISGAILFEETLYQSTVDGK
Sbjct: 61   AMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTVDGK 120

Query: 448  KIVDILVEQGIVPGIKVDKGLVPLVGSNDESWCQGLDGLASREAAYYQQGARFAKWRTVV 627
            KIVDIL EQ IVPGIKVDKGLVPL GSN+ESWCQGLDGLASREAAYYQQGARFAKWRTVV
Sbjct: 121  KIVDILTEQKIVPGIKVDKGLVPLAGSNNESWCQGLDGLASREAAYYQQGARFAKWRTVV 180

Query: 628  SIPNGPSELAVKEAAWGLARYAAISQDNGLVPIVEPEIMLDGEHGIERTFEVAQKVWAET 807
            SIPNGPSELAVKEAAWGLARYAAISQDNGLVPIVEPEI+LDGEHGI+RTFEVAQKVWAET
Sbjct: 181  SIPNGPSELAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGEHGIDRTFEVAQKVWAET 240

Query: 808  FYYMAQNNVMFEGILLKPSMVTPGAECKDRATPEEVASYTLKLLQRRIPPSVPGIMFLSG 987
            F+YMA+NNVMFEGILLKPSMVTPGAECKDRATPE+V+ YTLKLL RRIPP+VPGIMFLSG
Sbjct: 241  FFYMAENNVMFEGILLKPSMVTPGAECKDRATPEQVSDYTLKLLHRRIPPAVPGIMFLSG 300

Query: 988  GQSEVEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRPENVAAAQEALLLRAKAN 1167
            GQSEVEAT NLNAMNQ PNPWHVSFSYARALQNTCLKTWGG+PENV AAQ+ALLLRAKAN
Sbjct: 301  GQSEVEATQNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGQPENVKAAQDALLLRAKAN 360

Query: 1168 SLAQLGKYTSDGEAAAAKENMFVKNYSY 1251
            SLAQLGKYTSDGEAA AKE MFVKNY Y
Sbjct: 361  SLAQLGKYTSDGEAAEAKEGMFVKNYVY 388
  9639.m00638|protein  Fructose-bisphosphate aldolase class-I
            Length = 363
            
 Score =  666 bits (1701), Expect = 0.0
 Identities = 336/388 (86%), Positives = 348/388 (89%)
 Frame = +1

Query: 88   MASATLLKSSFLPKKAEWGATRQAAAPKPMTVSMVVRASAYADELVKTAKTIASPGRGIL 267
            MASATLLKSSFLPKK+EWGATRQAAAPKP+TVSMVVRA AY DELVKTAKTIASPGRGIL
Sbjct: 1    MASATLLKSSFLPKKSEWGATRQAAAPKPVTVSMVVRAGAYDDELVKTAKTIASPGRGIL 60

Query: 268  AMDESNATCGKRLASIGLENTEANRQAYRTLLVTPPGLGNYISGAILFEETLYQSTVDGK 447
            AMDESNATCGKRLASIGLENTEANRQAYRTLLVT PGLG YISGAILFEETLYQSTVDGK
Sbjct: 61   AMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTVDGK 120

Query: 448  KIVDILVEQGIVPGIKVDKGLVPLVGSNDESWCQGLDGLASREAAYYQQGARFAKWRTVV 627
            KIVDIL EQ IVPGIKVDKGLVPL GSN+ESWCQGLDGLASREAAYYQQGARFAKWRTVV
Sbjct: 121  KIVDILTEQKIVPGIKVDKGLVPLAGSNNESWCQGLDGLASREAAYYQQGARFAKWRTVV 180

Query: 628  SIPNGPSELAVKEAAWGLARYAAISQDNGLVPIVEPEIMLDGEHGIERTFEVAQKVWAET 807
            SIPNGPSELA                         PEI+LDGEHGI+RTFEVAQKVWAET
Sbjct: 181  SIPNGPSELA-------------------------PEILLDGEHGIDRTFEVAQKVWAET 215

Query: 808  FYYMAQNNVMFEGILLKPSMVTPGAECKDRATPEEVASYTLKLLQRRIPPSVPGIMFLSG 987
            F+YMA+NNVMFEGILLKPSMVTPGAECKDRATPE+V+ YTLKLL RRIPP+VPGIMFLSG
Sbjct: 216  FFYMAENNVMFEGILLKPSMVTPGAECKDRATPEQVSDYTLKLLHRRIPPAVPGIMFLSG 275

Query: 988  GQSEVEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRPENVAAAQEALLLRAKAN 1167
            GQSEVEAT NLNAMNQ PNPWHVSFSYARALQNTCLKTWGG+PENV AAQ+ALLLRAKAN
Sbjct: 276  GQSEVEATQNLNAMNQGPNPWHVSFSYARALQNTCLKTWGGQPENVKAAQDALLLRAKAN 335

Query: 1168 SLAQLGKYTSDGEAAAAKENMFVKNYSY 1251
            SLAQLGKYTSDGEAA AKE MFVKNY Y
Sbjct: 336  SLAQLGKYTSDGEAAEAKEGMFVKNYVY 363
  9629.m00200|protein  Fructose-bisphosphate aldolase class-I, putative
            Length = 1613
            
 Score =  545 bits (1388), Expect = e-154
 Identities = 277/369 (75%), Positives = 313/369 (84%), Gaps = 4/369 (1%)
 Frame = +1

Query: 124  PKKAEW--GATRQAAAPKPMTVSMVVRASA--YADELVKTAKTIASPGRGILAMDESNAT 291
            P    W  G  R++A P+  TV   +RA+A  YADELV TAK++ASPGRGILA+DESNAT
Sbjct: 12   PAATTWLPGGGRRSAPPRRATV---IRAAAVSYADELVSTAKSVASPGRGILAIDESNAT 68

Query: 292  CGKRLASIGLENTEANRQAYRTLLVTPPGLGNYISGAILFEETLYQSTVDGKKIVDILVE 471
            CGKRLASIGL+NTE NRQAYR LL+T  GLG YISGAILFEETLYQST DGKK VD L +
Sbjct: 69   CGKRLASIGLDNTEVNRQAYRQLLLTTAGLGEYISGAILFEETLYQSTTDGKKFVDCLKD 128

Query: 472  QGIVPGIKVDKGLVPLVGSNDESWCQGLDGLASREAAYYQQGARFAKWRTVVSIPNGPSE 651
            Q I+PGIKVDKGLVPL GSN+ESWCQGLDGLASR              RTVVSIP GPS 
Sbjct: 129  QNIMPGIKVDKGLVPLPGSNNESWCQGLDGLASR--------------RTVVSIPCGPSA 174

Query: 652  LAVKEAAWGLARYAAISQDNGLVPIVEPEIMLDGEHGIERTFEVAQKVWAETFYYMAQNN 831
            LAVKEAAWGLARYAAI+QDNGLVPIVEPEI+LDG+H IERT EVA+KVW+E F+Y+AQNN
Sbjct: 175  LAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHAIERTLEVAEKVWSEVFFYLAQNN 234

Query: 832  VMFEGILLKPSMVTPGAECKDRATPEEVASYTLKLLQRRIPPSVPGIMFLSGGQSEVEAT 1011
            V+FEGILLKPSMVTPGAE K +ATPE +A +TL +L+RR+PP+VPGIMFLSGGQSEVEAT
Sbjct: 235  VLFEGILLKPSMVTPGAEHKQKATPEAIAKHTLTMLRRRVPPAVPGIMFLSGGQSEVEAT 294

Query: 1012 LNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRPENVAAAQEALLLRAKANSLAQLGKY 1191
            LNLNAMNQ PNPWHVSFSYARALQN+ LKTW GRPENV AAQ+ALL+RAKANSLAQLG+Y
Sbjct: 295  LNLNAMNQEPNPWHVSFSYARALQNSVLKTWQGRPENVEAAQKALLVRAKANSLAQLGRY 354

Query: 1192 TSDGEAAAAKENM 1230
            T +GE+  AK+ +
Sbjct: 355  TGEGESDEAKKGI 367
  9634.m03902|protein  Fructose-bisphosphate aldolase class-I
            Length = 358
            
 Score =  387 bits (984), Expect = e-107
 Identities = 203/348 (58%), Positives = 248/348 (70%), Gaps = 4/348 (1%)
 Frame = +1

Query: 208  YADELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTPPGLGN 387
            YADEL+KTAK IA+PG+GILA DES  T GKRLASI +EN E NRQA R LL T PG   
Sbjct: 8    YADELIKTAKYIATPGKGILAADESTGTIGKRLASINVENVEPNRQALRELLFTTPGAFQ 67

Query: 388  YISGAILFEETLYQSTVDGKKIVDILVEQGIVPGIKVDKGLVPLVGSNDESWCQGLDGLA 567
            Y+SG ILFEETLYQST  G   VD+L   G+VPGIKVDKG V + G+N E+  QGLD L 
Sbjct: 68   YLSGVILFEETLYQSTAAGTPFVDVLKAGGVVPGIKVDKGTVDIAGTNGETTTQGLDSLG 127

Query: 568  SREAAYYQQGARFAKWRTVVSI--PNGPSELAVKEAAWGLARYAAISQDNGLVPIVEPEI 741
            +R A YY+ GARFAKWR V+ I     PSELAVK+ A GLARYA I Q+NGLVPIVEPEI
Sbjct: 128  ARCAKYYEAGARFAKWRAVLKIGAAGEPSELAVKQNAEGLARYALICQENGLVPIVEPEI 187

Query: 742  MLDGEHGIERTFEVAQKVWAETFYYMAQNNVMFEGILLKPSMVTPGAECKDRATPEEVAS 921
            + DG H I+    V ++V A  +  +  + V+ EG LLKP+MVTPG++   +   E +  
Sbjct: 188  LTDGAHDIKTCAAVTERVLAAVYKSLNDHKVLLEGTLLKPNMVTPGSD-SPKVGAEVIGE 246

Query: 922  YTLKLLQRRIPPSVPGIMFLSGGQSEVEATLNLNAMN--QAPNPWHVSFSYARALQNTCL 1095
            YT+  L+R +PP+VPGI+FLSGGQSE EA+ NLNAMN  +   PW ++FS+ RALQ + +
Sbjct: 247  YTVAALRRTVPPAVPGIVFLSGGQSEEEASQNLNAMNKLEVLKPWTLTFSFGRALQQSTI 306

Query: 1096 KTWGGRPENVAAAQEALLLRAKANSLAQLGKYTSDGEAAAAKENMFVKNYSY 1251
            K WGG+ ENVAAAQ A L R KANS A LGKY      AA  E+++VK Y+Y
Sbjct: 307  KKWGGKKENVAAAQAAFLARCKANSEATLGKYGGAAGDAATSESLYVKGYTY 358
  9629.m06736|protein  Fructose-bisphosphate aldolase class-I
            Length = 358
            
 Score =  379 bits (963), Expect = e-105
 Identities = 197/348 (56%), Positives = 248/348 (70%), Gaps = 4/348 (1%)
 Frame = +1

Query: 208  YADELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTPPGLGN 387
            Y DEL+K A  I +PG+GILA DES  T GKR ASI +EN E NR++ R LL T PG   
Sbjct: 8    YKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLFTTPGALQ 67

Query: 388  YISGAILFEETLYQSTVDGKKIVDILVEQGIVPGIKVDKGLVPLVGSNDESWCQGLDGLA 567
            ++SG ILFEETLYQ T DGK  VD+L E G++PGIKVDKG V + G+N E+  QG D L 
Sbjct: 68   HLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTVEVAGTNKETTTQGHDDLG 127

Query: 568  SREAAYYQQGARFAKWRTVVSI-PNGPSELAVKEAAWGLARYAAISQDNGLVPIVEPEIM 744
             R A YY+ GARFAKWR V+ I PN PS+L++   A GLARYA I Q+NGLVPIVEPEI+
Sbjct: 128  KRCAKYYEAGARFAKWRAVLKIGPNEPSQLSIDLNAQGLARYAIICQENGLVPIVEPEIL 187

Query: 745  LDGEHGIERTFEVAQKVWAETFYYMAQNNVMFEGILLKPSMVTPGAECKDRATPEEVASY 924
            +DG H IER   V +KV A  +  + +++V+ EG LLKP+MVTPG+E K + +P+ +A Y
Sbjct: 188  VDGSHDIERCAYVTEKVLAACYKALNEHHVLLEGSLLKPNMVTPGSESK-KVSPQLIAEY 246

Query: 925  TLKLLQRRIPPSVPGIMFLSGGQSEVEATLNLNAMNQ--APNPWHVSFSYARALQNTCLK 1098
            T++ LQR +P +VP I+FLSGGQSE EAT+NLNAMN+     PW +SFS+ RALQ + LK
Sbjct: 247  TVRALQRTVPAAVPAIVFLSGGQSEEEATVNLNAMNKLSTKKPWALSFSFGRALQQSTLK 306

Query: 1099 TWGGRPENVAAAQEALLLRAKANSLAQLGKYTSDGE-AAAAKENMFVKNYSY 1251
             WGG+ ENV  AQ+A + R KANS A LG Y  D      A E++ VK+Y Y
Sbjct: 307  AWGGKTENVVKAQKAFITRCKANSEATLGTYQGDAVLGEGASESLHVKDYKY 358
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 110385187 Number of Sequences: 59712 Number of extensions: 3413756 Number of successful extensions: 24727 Number of sequences better than 1.0e-10: 18 Number of HSP's better than 0.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 24698 Number of HSP's gapped (non-prelim): 13 length of query: 540 length of database: 26,991,925 effective HSP length: 52 effective length of query: 488 effective length of database: 23,886,901 effective search space: 11656807688 effective search space used: 11656807688 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG1204   Members:542            3pri:Y   1e-113     
 AAP87284.1       cytosolic heat shock protein 90 [Hordeum vulgare]
         (2561 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9637.m02719|protein  Similar to heat shock protein 82          1338  0.0
 9636.m03953|protein  Similar to heat shock protein 82          1335  0.0
 9636.m03952|protein  Similar to heat shock protein 82          1180  0.0
 9632.m00078|protein  Similar to heat shock protein HSP82 -...  1178  0.0
 9634.m04916|protein  Hsp90 protein, putative                    640  0.0
 9637.m02656|protein  heat-shock protein, 82K, precursor - rye   609  e-174
 9636.m03832|protein  heat-shock protein, 82K, precursor - rye   605  e-173
 9636.m03831|protein  heat-shock protein, 82K, precursor - rye   605  e-173
 9640.m03211|protein  AC009176 putative heat-shock protein       598  e-170
 9637.m03067|protein  Similar to heat shock protein 90A          457  e-128

  9637.m02719|protein  Similar to heat shock protein 82
            Length = 699
            
 Score = 1338 bits (3426), Expect = 0.0
 Identities = 663/700 (94%), Positives = 689/700 (97%)
 Frame = +3

Query: 75   MATETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA 254
            MA+ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA
Sbjct: 1    MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA 60

Query: 255  QPELFIHIIPDKATSTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG 434
            QPELFIHI+PDKA++TL+I+DSG+GMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG
Sbjct: 61   QPELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG 120

Query: 435  QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMVLYLK 614
            QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTK+ LYLK
Sbjct: 121  QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK 180

Query: 615  DDQMEYLEERRIKDLVKKHSEFISYPISLWTEKTTEKEISDDEDEEEKKDTEEGKVEDVD 794
            DDQ+EYLEERR+KDLVKKHSEFISYPISLWTEKTTEKEISDDEDEEEKKD EEGKVEDVD
Sbjct: 181  DDQLEYLEERRLKDLVKKHSEFISYPISLWTEKTTEKEISDDEDEEEKKDAEEGKVEDVD 240

Query: 795  EEKEEKEKKKKKIKEVSHEWNLVNKQKPIWMRKPEEINKEEYAAFYKSLTNDWEEHLAVK 974
            EEKEEKEKKKKKIKEVSHEWN++NKQKPIW+RKPEEI KEEYAAFYKSLTNDWEEHLAVK
Sbjct: 241  EEKEEKEKKKKKIKEVSHEWNVMNKQKPIWLRKPEEITKEEYAAFYKSLTNDWEEHLAVK 300

Query: 975  HFSVEGQLEFKAVLFVPKRAPFDLFDNKKKANNIKLYVRRVFIMDNCDELIPEYLSFVKG 1154
            HFSVEGQLEFKA+LFVPKRAPFDLFD +KK NNIKLYVRRVFIMDNC+ELIPE+LSFVKG
Sbjct: 301  HFSVEGQLEFKAILFVPKRAPFDLFDTRKKQNNIKLYVRRVFIMDNCEELIPEWLSFVKG 360

Query: 1155 IVDSEDLPLNISRETLQQNKILKVIRKNLVKKCIELFFEIAENKEDYNKFYEAFSKNLKL 1334
            IVDSEDLPLNISRE LQQNKILKVIRKNLVKKC+ELFFEIAENKEDYNKFYEAFSKNLKL
Sbjct: 361  IVDSEDLPLNISREMLQQNKILKVIRKNLVKKCVELFFEIAENKEDYNKFYEAFSKNLKL 420

Query: 1335 GIHEDSQNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNEIYYITGESKKAVENSPF 1514
            GIHEDS NRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQ+EIYYITGESKKAVENSPF
Sbjct: 421  GIHEDSTNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQSEIYYITGESKKAVENSPF 480

Query: 1515 LEKLKKKGYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEK 1694
            LEKLKKKGYEV+YMVDAIDEYA+GQLKEFEGKKLVSATKEGLKLDESEDEKK+QEELKEK
Sbjct: 481  LEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRQEELKEK 540

Query: 1695 FEGLCKVIKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGY 1874
            FEGLCKVIKEVLGDKVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGY
Sbjct: 541  FEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGY 600

Query: 1875 MSSKKTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTR 2054
            MSSKKTMEINPEN+IMDELRKRADADKNDKSVKDLVMLLFET+LLTSGFSLEDPNTFGTR
Sbjct: 601  MSSKKTMEINPENSIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGTR 660

Query: 2055 IHRMLKLGLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD 2174
            IHRMLKLGLSIDED+ A E D DMPPLEDDAGESKMEEVD
Sbjct: 661  IHRMLKLGLSIDEDESA-EADADMPPLEDDAGESKMEEVD 699
  9636.m03953|protein  Similar to heat shock protein 82
            Length = 699
            
 Score = 1335 bits (3417), Expect = 0.0
 Identities = 662/700 (94%), Positives = 689/700 (97%)
 Frame = +3

Query: 75   MATETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA 254
            MA+ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA
Sbjct: 1    MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA 60

Query: 255  QPELFIHIIPDKATSTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG 434
            QPELFIHI+PDKA++TL+I+DSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG
Sbjct: 61   QPELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG 120

Query: 435  QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMVLYLK 614
            QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTK+ LYLK
Sbjct: 121  QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK 180

Query: 615  DDQMEYLEERRIKDLVKKHSEFISYPISLWTEKTTEKEISDDEDEEEKKDTEEGKVEDVD 794
            DDQ+EYLEERR+KDL+KKHSEFISYPISLWTEKTTEKEISDDEDEEEKKD EEGKVEDVD
Sbjct: 181  DDQLEYLEERRLKDLIKKHSEFISYPISLWTEKTTEKEISDDEDEEEKKDAEEGKVEDVD 240

Query: 795  EEKEEKEKKKKKIKEVSHEWNLVNKQKPIWMRKPEEINKEEYAAFYKSLTNDWEEHLAVK 974
            EEKEEKEKKKKKIKEVSHEW+LVNKQKPIWMRKPEEI KEEYAAFYKSLTNDWEEHLAVK
Sbjct: 241  EEKEEKEKKKKKIKEVSHEWSLVNKQKPIWMRKPEEITKEEYAAFYKSLTNDWEEHLAVK 300

Query: 975  HFSVEGQLEFKAVLFVPKRAPFDLFDNKKKANNIKLYVRRVFIMDNCDELIPEYLSFVKG 1154
            HFSVEGQLEFKAVLFVPKRAPFDLFD +KK NNIKLYVRRVFIMDNC+ELIPE+LSFVKG
Sbjct: 301  HFSVEGQLEFKAVLFVPKRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPEWLSFVKG 360

Query: 1155 IVDSEDLPLNISRETLQQNKILKVIRKNLVKKCIELFFEIAENKEDYNKFYEAFSKNLKL 1334
            IVDSEDLPLNISRE LQQNKILKVIRKNLVKKC+ELFFEIAENKEDYNKFYEAFSKNLKL
Sbjct: 361  IVDSEDLPLNISREMLQQNKILKVIRKNLVKKCVELFFEIAENKEDYNKFYEAFSKNLKL 420

Query: 1335 GIHEDSQNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNEIYYITGESKKAVENSPF 1514
            GIHEDS NR KIAELLRYHSTKSGDELTSLKDYVTRMKEGQN+IYYITGESKKAVENSPF
Sbjct: 421  GIHEDSTNRNKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPF 480

Query: 1515 LEKLKKKGYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEK 1694
            LEKLKKKGYEV+YMVDAIDEYA+GQLKEFEGKKLVSATKEGLKLDESEDEKK++EELKEK
Sbjct: 481  LEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEK 540

Query: 1695 FEGLCKVIKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGY 1874
            FEGLCKVIKEVLGDKVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGY
Sbjct: 541  FEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGY 600

Query: 1875 MSSKKTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTR 2054
            MSSKKTMEINPENAIM+ELRKRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG+R
Sbjct: 601  MSSKKTMEINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSR 660

Query: 2055 IHRMLKLGLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD 2174
            IHRMLKLGLSIDED+ A E DTDMPPLEDDAGESKMEEVD
Sbjct: 661  IHRMLKLGLSIDEDETA-EADTDMPPLEDDAGESKMEEVD 699
  9636.m03952|protein  Similar to heat shock protein 82
            Length = 614
            
 Score = 1180 bits (3019), Expect = 0.0
 Identities = 583/615 (94%), Positives = 604/615 (97%)
 Frame = +3

Query: 330  MTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDD 509
            MTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDD
Sbjct: 1    MTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDD 60

Query: 510  EQYVWESQAGGSFTVTRDTSGEQLGRGTKMVLYLKDDQMEYLEERRIKDLVKKHSEFISY 689
            EQYVWESQAGGSFTVTRDTSGEQLGRGTK+ LYLKDDQ+EYLEERR+KDL+KKHSEFISY
Sbjct: 61   EQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDDQLEYLEERRLKDLIKKHSEFISY 120

Query: 690  PISLWTEKTTEKEISDDEDEEEKKDTEEGKVEDVDEEKEEKEKKKKKIKEVSHEWNLVNK 869
            PISLWTEKTTEKEISDDEDEEEKKD EEGKVEDVDEEKEEKEKKKKKIKEVSHEW+LVNK
Sbjct: 121  PISLWTEKTTEKEISDDEDEEEKKDAEEGKVEDVDEEKEEKEKKKKKIKEVSHEWSLVNK 180

Query: 870  QKPIWMRKPEEINKEEYAAFYKSLTNDWEEHLAVKHFSVEGQLEFKAVLFVPKRAPFDLF 1049
            QKPIWMRKPEEI KEEYAAFYKSLTNDWEEHLAVKHFSVEGQLEFKAVLFVPKRAPFDLF
Sbjct: 181  QKPIWMRKPEEITKEEYAAFYKSLTNDWEEHLAVKHFSVEGQLEFKAVLFVPKRAPFDLF 240

Query: 1050 DNKKKANNIKLYVRRVFIMDNCDELIPEYLSFVKGIVDSEDLPLNISRETLQQNKILKVI 1229
            D +KK NNIKLYVRRVFIMDNC+ELIPE+LSFVKGIVDSEDLPLNISRE LQQNKILKVI
Sbjct: 241  DTRKKLNNIKLYVRRVFIMDNCEELIPEWLSFVKGIVDSEDLPLNISREMLQQNKILKVI 300

Query: 1230 RKNLVKKCIELFFEIAENKEDYNKFYEAFSKNLKLGIHEDSQNRTKIAELLRYHSTKSGD 1409
            RKNLVKKC+ELFFEIAENKEDYNKFYEAFSKNLKLGIHEDS NR KIAELLRYHSTKSGD
Sbjct: 301  RKNLVKKCVELFFEIAENKEDYNKFYEAFSKNLKLGIHEDSTNRNKIAELLRYHSTKSGD 360

Query: 1410 ELTSLKDYVTRMKEGQNEIYYITGESKKAVENSPFLEKLKKKGYEVIYMVDAIDEYAIGQ 1589
            ELTSLKDYVTRMKEGQN+IYYITGESKKAVENSPFLEKLKKKGYEV+YMVDAIDEYA+GQ
Sbjct: 361  ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQ 420

Query: 1590 LKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKVIKEVLGDKVEKVIVSDRV 1769
            LKEFEGKKLVSATKEGLKLDESEDEKK++EELKEKFEGLCKVIKEVLGDKVEKV+VSDRV
Sbjct: 421  LKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKVIKEVLGDKVEKVVVSDRV 480

Query: 1770 VDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELRKRADA 1949
            VDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIM+ELRKRADA
Sbjct: 481  VDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMEELRKRADA 540

Query: 1950 DKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDDEAPENDTDMP 2129
            DKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG+RIHRMLKLGLSIDED+ A E DTDMP
Sbjct: 541  DKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDEDETA-EADTDMP 599

Query: 2130 PLEDDAGESKMEEVD 2174
            PLEDDAGESKMEEVD
Sbjct: 600  PLEDDAGESKMEEVD 614
  9632.m00078|protein  Similar to heat shock protein HSP82 - maize
            Length = 703
            
 Score = 1178 bits (3015), Expect = 0.0
 Identities = 584/703 (83%), Positives = 649/703 (92%), Gaps = 2/703 (0%)
 Frame = +3

Query: 66   DAAMATETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSK 245
            D  MA E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSK
Sbjct: 6    DVQMA-EKETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSK 64

Query: 246  LDAQPELFIHIIPDKATSTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVS 425
            LDAQPELFI ++P K + TL+I+DSG+GMTKSDLVNNLGTIARSGTKEFMEAL AGADVS
Sbjct: 65   LDAQPELFIRLVPYKPSKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGADVS 124

Query: 426  MIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMVL 605
            MIGQFGVGFYSAYLVAE+VVVTTKHNDDEQYVWESQAGGSFTVT DT+GE+LGRGTK+ L
Sbjct: 125  MIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTLDTAGERLGRGTKITL 184

Query: 606  YLKDDQMEYLEERRIKDLVKKHSEFISYPISLWTEKTTEKEISDDEDEEEKKDTEEGKVE 785
            +LKDDQ+EYLEERR+KDLVKKHSEFISYPI LW+EKTTEKEISDDED++   D  +GK +
Sbjct: 185  FLKDDQLEYLEERRLKDLVKKHSEFISYPIYLWSEKTTEKEISDDEDDDI--DDSKGKEK 242

Query: 786  DVDEEKEEKEKKKKKIKEVSHEWNLVNKQKPIWMRKPEEINKEEYAAFYKSLTNDWEEHL 965
            + D E+ + +KKKKK+ EVSHEW  +NKQKPIW+RKPEEI++EEYA+FYKSLTNDWE+HL
Sbjct: 243  EGDIEEVKDKKKKKKVNEVSHEWVQINKQKPIWLRKPEEISREEYASFYKSLTNDWEDHL 302

Query: 966  AVKHFSVEGQLEFKAVLFVPKRAPFDLFDNKKKANNIKLYVRRVFIMDNCDELIPEYLSF 1145
            AVKHFSVEGQLEFKA+LFVP+RAPFDLFD +KK NNIKLYVRRVFIMDNC+ELIPE+L F
Sbjct: 303  AVKHFSVEGQLEFKAILFVPRRAPFDLFDTRKKMNNIKLYVRRVFIMDNCEELIPEWLGF 362

Query: 1146 VKGIVDSEDLPLNISRETLQQNKILKVIRKNLVKKCIELFFEIAENKEDYNKFYEAFSKN 1325
            VKG+VDS+DLPLNISRE LQQNKILKVIRKNLVKKCIE+FFEIA+NKEDY KFYEAFSKN
Sbjct: 363  VKGVVDSDDLPLNISREMLQQNKILKVIRKNLVKKCIEMFFEIADNKEDYAKFYEAFSKN 422

Query: 1326 LKLGIHEDSQNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNEIYYITGESKKAVEN 1505
            LKLGIHEDSQNR K+A+LLRYHSTKSG+ELTSLKDYVTRMKEGQ E+YYITGES+KAVEN
Sbjct: 423  LKLGIHEDSQNRGKLADLLRYHSTKSGNELTSLKDYVTRMKEGQKEVYYITGESRKAVEN 482

Query: 1506 SPFLEKLKKKGYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEEL 1685
            SPFLEKLKKKGYEV++MVDAIDEYA+GQLKE++GKKLVSATKEGLKLD+ +D K    E 
Sbjct: 483  SPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDDDDAK----ER 538

Query: 1686 KEKFEGLCKVIKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM 1865
            K  FE LCKVIK++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM
Sbjct: 539  KRSFEPLCKVIKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSM 598

Query: 1866 AGYMSSKKTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTF 2045
              YMSSKKTMEINPEN IM+ELRKRADAD NDKSV+DLV+LLFET+LLTSGFSL+DPNTF
Sbjct: 599  GAYMSSKKTMEINPENGIMEELRKRADADANDKSVRDLVLLLFETALLTSGFSLDDPNTF 658

Query: 2046 GTRIHRMLKLGLSIDEDD-EAPENDTDMPPLEDDAG-ESKMEEVD 2174
              RIHRMLKLGL+ID+DD  A ++D DMP L+D A  ESKMEEVD
Sbjct: 659  AARIHRMLKLGLNIDDDDAAAADDDADMPALDDAAAEESKMEEVD 703
  9634.m04916|protein  Hsp90 protein, putative
            Length = 818
            
 Score =  640 bits (1632), Expect = 0.0
 Identities = 337/705 (47%), Positives = 480/705 (67%), Gaps = 33/705 (4%)
 Frame = +3

Query: 54   EQLRDAAMATETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLT 233
            E +    + +  E F FQAE+++L+ +IIN+ YSNK+IFLRELISN+SDALDKIRF +LT
Sbjct: 93   ESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALT 152

Query: 234  DKSKLDA--QPELFIHIIPDKATSTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEALA 407
            DK  L      +L I I  DK    L+I D GI                     F+E + 
Sbjct: 153  DKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIA--------------------FVEKMQ 192

Query: 408  AGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGR 587
             G D+++IGQFGVGFYS YLVA+ V V +KHNDD+Q+VWES+A GSF ++ DT  E LGR
Sbjct: 193  TGGDLNLIGQFGVGFYSVYLVADYVEVISKHNDDKQHVWESKADGSFAISEDTWNEPLGR 252

Query: 588  GTKMVLYLKDDQMEYLEERRIKDLVKKHSEFISYPISLWTEKTTEKEISDDEDE-----E 752
            GT++ L+L+D+  EY+EE ++KDLVKK+SEFI++PI LW  K  + E+  DEDE     E
Sbjct: 253  GTEIRLHLRDEAKEYVEEDKLKDLVKKYSEFINFPIYLWATKEVDVEVPADEDESSESSE 312

Query: 753  EKKDTEEGKVEDVDEEKEEKEKKKKKIKEVSHEWNLVNKQKPIWMRKPEEINKEEYAAFY 932
            E++ + E   E+  EE EEK+ K K +KE + EW L+N  K IW+R P+E+ +EEY  FY
Sbjct: 313  EEESSPESTEEEETEESEEKKPKTKTVKETTTEWELLNDVKAIWLRSPKEVTEEEYTKFY 372

Query: 933  KSLTNDW--EEHLAVKHFSVEGQLEFKAVLFVPKRAPFDLFDNKKKAN--NIKLYVRRVF 1100
             SL  D+  ++ L+  HF+ EG +EFKA+LFVP +AP DL+++   +N  N+KLYVRRVF
Sbjct: 373  HSLAKDFGDDKPLSWSHFTAEGDVEFKALLFVPPKAPHDLYESYYNSNKSNLKLYVRRVF 432

Query: 1101 IMDNCDELIPEYLSFVKGIVDSEDLPLNISRETLQQNKILKVIRKNLVKKCIELFFEIAE 1280
            I D  DEL+P+YLSF+KG+VDS+ LPLN+SRE LQQ+  LK I+K L++K +++  ++AE
Sbjct: 433  ISDEFDELLPKYLSFLKGLVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRKLAE 492

Query: 1281 NKED---------------------YNKFYEAFSKNLKLGIHEDSQNRTKIAELLRYHST 1397
               D                     Y KF+  F K++KLGI ED+ NR ++A+LLR+ ST
Sbjct: 493  EDPDEYSNKDKTDEEKSAMEEKKGQYAKFWNEFGKSVKLGIIEDATNRNRLAKLLRFEST 552

Query: 1398 KSGDELTSLKDYVTRMKEGQNEIYYITGESKKAVENSPFLEKLKKKGYEVIYMVDAIDEY 1577
            KS  +L SL +Y++RMK GQ +I+YITG SK+ +E SPFLE+L KK YEVIY  D +DEY
Sbjct: 553  KSEGKLASLDEYISRMKPGQKDIFYITGSSKEQLEKSPFLERLTKKNYEVIYFTDPVDEY 612

Query: 1578 AIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKVIKEVLG-DKVEKVI 1754
             +  L ++E KK  + +KEGLKL +      K ++LKE F+ L    K+ L  + V+ V 
Sbjct: 613  LMQYLMDYEDKKFQNVSKEGLKLGKD----SKLKDLKESFKELTDWWKKALDTESVDSVK 668

Query: 1755 VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMDELR 1934
            +S+R+ D+PC +VT +YGW+ANME+IM++Q L D+S   YM  K+ +EINP + I+ ELR
Sbjct: 669  ISNRLSDTPCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR 728

Query: 1935 KRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKLGLSIDEDDEAPEN 2114
             +   D   +S+K    L+++T+L+ SGF+L DP  F + I+R ++  L +  D    E 
Sbjct: 729  DKVAQDSESESLKQTAKLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSPDAAVEE- 787

Query: 2115 DTDMPPLEDDAGESKMEE 2168
                   E++  E+++EE
Sbjct: 788  -------EEEVEEAEVEE 798
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 163419082 Number of Sequences: 59712 Number of extensions: 5093325 Number of successful extensions: 61908 Number of sequences better than 1.0e-10: 20 Number of HSP's better than 0.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 61723 Number of HSP's gapped (non-prelim): 35 length of query: 853 length of database: 26,991,925 effective HSP length: 53 effective length of query: 800 effective length of database: 23,827,189 effective search space: 19061751200 effective search space used: 19061751200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 162 (67.5 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG1206   Members:203            3pri:Y   1e-123     
 AAD11549.1       heat shock protein 80 [Triticum aestivum]
         (2566 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9636.m03953|protein  Similar to heat shock protein 82          1342  0.0
 9637.m02719|protein  Similar to heat shock protein 82          1331  0.0
 9632.m00078|protein  Similar to heat shock protein HSP82 -...  1195  0.0
 9636.m03952|protein  Similar to heat shock protein 82          1185  0.0
 9634.m04916|protein  Hsp90 protein, putative                    646  0.0
 9637.m02656|protein  heat-shock protein, 82K, precursor - rye   607  e-173
 9636.m03832|protein  heat-shock protein, 82K, precursor - rye   603  e-172
 9636.m03831|protein  heat-shock protein, 82K, precursor - rye   603  e-172
 9640.m03211|protein  AC009176 putative heat-shock protein       592  e-169
 9637.m03067|protein  Similar to heat shock protein 90A          445  e-124

  9636.m03953|protein  Similar to heat shock protein 82
            Length = 699
            
 Score = 1342 bits (3434), Expect = 0.0
 Identities = 662/700 (94%), Positives = 692/700 (98%)
 Frame = +1

Query: 166  MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDA 345
            MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDA
Sbjct: 1    MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA 60

Query: 346  QPELFIHIIPDKATNTLTLIDSGIGMTKSDLVNNLGTIARSGTKDFMEALAAGADVSMIG 525
            QPELFIHI+PDKA+NTL++IDSGIGMTKSDLVNNLGTIARSGTK+FMEALAAGADVSMIG
Sbjct: 61   QPELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG 120

Query: 526  QFGVGFYSAYLVAERVVVTSKHNDDEQYVWESQAGGSFTVTRDTTGEPLGRGTKITLYLK 705
            QFGVGFYSAYLVAERVVVT+KHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITLYLK
Sbjct: 121  QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK 180

Query: 706  DDQLEYLEERRLKDLVKKHSEFISYPISLWTEKTTEKEISDDEDEDEKKDTEEGKVEEID 885
            DDQLEYLEERRLKDL+KKHSEFISYPISLWTEKTTEKEISDDEDE+EKKD EEGKVE++D
Sbjct: 181  DDQLEYLEERRLKDLIKKHSEFISYPISLWTEKTTEKEISDDEDEEEKKDAEEGKVEDVD 240

Query: 886  EEKEEKEKKKKKIKEVSHEWNLINKQKPIWMRKPEEITKDEYAAFYKSLTNDWEEHLAVK 1065
            EEKEEKEKKKKKIKEVSHEW+L+NKQKPIWMRKPEEITK+EYAAFYKSLTNDWEEHLAVK
Sbjct: 241  EEKEEKEKKKKKIKEVSHEWSLVNKQKPIWMRKPEEITKEEYAAFYKSLTNDWEEHLAVK 300

Query: 1066 HFSVEGQLEFKAVLFVPKRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPEWLSFVKG 1245
            HFSVEGQLEFKAVLFVPKRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPEWLSFVKG
Sbjct: 301  HFSVEGQLEFKAVLFVPKRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPEWLSFVKG 360

Query: 1246 IVDSEDLPLNISRETLQQNKILKVIRKNLVKKCIELFFEIAENKEDYTKFYEAFSKNLKL 1425
            IVDSEDLPLNISRE LQQNKILKVIRKNLVKKC+ELFFEIAENKEDY KFYEAFSKNLKL
Sbjct: 361  IVDSEDLPLNISREMLQQNKILKVIRKNLVKKCVELFFEIAENKEDYNKFYEAFSKNLKL 420

Query: 1426 GVHEDSTNRTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPF 1605
            G+HEDSTNR K+AELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPF
Sbjct: 421  GIHEDSTNRNKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPF 480

Query: 1606 LEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDDSEEEKKRKEELKEK 1785
            LEKLKKKGYEVLYMVDAIDEY++GQLKEFEGKKLVSATKEGLKLD+SE+EKKRKEELKEK
Sbjct: 481  LEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEK 540

Query: 1786 FEGLCKVIKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGY 1965
            FEGLCKVIK+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GY
Sbjct: 541  FEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGY 600

Query: 1966 MSSKKTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTR 2145
            MSSKKTMEINPENAIMEELRKRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG+R
Sbjct: 601  MSSKKTMEINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSR 660

Query: 2146 IHRMLKLGLSIDEDDEPAEADTDMPPLEEDAGESKMEEVD 2265
            IHRMLKLGLSIDE DE AEADTDMPPLE+DAGESKMEEVD
Sbjct: 661  IHRMLKLGLSIDE-DETAEADTDMPPLEDDAGESKMEEVD 699
  9637.m02719|protein  Similar to heat shock protein 82
            Length = 699
            
 Score = 1331 bits (3408), Expect = 0.0
 Identities = 655/700 (93%), Positives = 691/700 (98%)
 Frame = +1

Query: 166  MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDA 345
            MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDA
Sbjct: 1    MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA 60

Query: 346  QPELFIHIIPDKATNTLTLIDSGIGMTKSDLVNNLGTIARSGTKDFMEALAAGADVSMIG 525
            QPELFIHI+PDKA+NTL++IDSG+GMTKSDLVNNLGTIARSGTK+FMEALAAGADVSMIG
Sbjct: 61   QPELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG 120

Query: 526  QFGVGFYSAYLVAERVVVTSKHNDDEQYVWESQAGGSFTVTRDTTGEPLGRGTKITLYLK 705
            QFGVGFYSAYLVAERVVVT+KHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITLYLK
Sbjct: 121  QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK 180

Query: 706  DDQLEYLEERRLKDLVKKHSEFISYPISLWTEKTTEKEISDDEDEDEKKDTEEGKVEEID 885
            DDQLEYLEERRLKDLVKKHSEFISYPISLWTEKTTEKEISDDEDE+EKKD EEGKVE++D
Sbjct: 181  DDQLEYLEERRLKDLVKKHSEFISYPISLWTEKTTEKEISDDEDEEEKKDAEEGKVEDVD 240

Query: 886  EEKEEKEKKKKKIKEVSHEWNLINKQKPIWMRKPEEITKDEYAAFYKSLTNDWEEHLAVK 1065
            EEKEEKEKKKKKIKEVSHEWN++NKQKPIW+RKPEEITK+EYAAFYKSLTNDWEEHLAVK
Sbjct: 241  EEKEEKEKKKKKIKEVSHEWNVMNKQKPIWLRKPEEITKEEYAAFYKSLTNDWEEHLAVK 300

Query: 1066 HFSVEGQLEFKAVLFVPKRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPEWLSFVKG 1245
            HFSVEGQLEFKA+LFVPKRAPFDLFDTRKK NNIKLYVRRVFIMDNCEELIPEWLSFVKG
Sbjct: 301  HFSVEGQLEFKAILFVPKRAPFDLFDTRKKQNNIKLYVRRVFIMDNCEELIPEWLSFVKG 360

Query: 1246 IVDSEDLPLNISRETLQQNKILKVIRKNLVKKCIELFFEIAENKEDYTKFYEAFSKNLKL 1425
            IVDSEDLPLNISRE LQQNKILKVIRKNLVKKC+ELFFEIAENKEDY KFYEAFSKNLKL
Sbjct: 361  IVDSEDLPLNISREMLQQNKILKVIRKNLVKKCVELFFEIAENKEDYNKFYEAFSKNLKL 420

Query: 1426 GVHEDSTNRTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPF 1605
            G+HEDSTNRTK+AELLRYHSTKSGDELTSLKDYVTRMKEGQ++IYYITGESKKAVENSPF
Sbjct: 421  GIHEDSTNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQSEIYYITGESKKAVENSPF 480

Query: 1606 LEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDDSEEEKKRKEELKEK 1785
            LEKLKKKGYEVLYMVDAIDEY++GQLKEFEGKKLVSATKEGLKLD+SE+EKKR+EELKEK
Sbjct: 481  LEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRQEELKEK 540

Query: 1786 FEGLCKVIKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGY 1965
            FEGLCKVIK+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GY
Sbjct: 541  FEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGY 600

Query: 1966 MSSKKTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTR 2145
            MSSKKTMEINPEN+IM+ELRKRADADKNDKSVKDLVMLLFET+LLTSGFSL+DPNTFGTR
Sbjct: 601  MSSKKTMEINPENSIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGTR 660

Query: 2146 IHRMLKLGLSIDEDDEPAEADTDMPPLEEDAGESKMEEVD 2265
            IHRMLKLGLSIDE DE AEAD DMPPLE+DAGESKMEEVD
Sbjct: 661  IHRMLKLGLSIDE-DESAEADADMPPLEDDAGESKMEEVD 699
  9632.m00078|protein  Similar to heat shock protein HSP82 - maize
            Length = 703
            
 Score = 1195 bits (3057), Expect = 0.0
 Identities = 592/706 (83%), Positives = 652/706 (91%), Gaps = 2/706 (0%)
 Frame = +1

Query: 148  SAAGGAMASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTD 327
            +AAG    +E ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTD
Sbjct: 2    AAAGDVQMAEKETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTD 61

Query: 328  KSKLDAQPELFIHIIPDKATNTLTLIDSGIGMTKSDLVNNLGTIARSGTKDFMEALAAGA 507
            KSKLDAQPELFI ++P K + TL++IDSG+GMTKSDLVNNLGTIARSGTK+FMEAL AGA
Sbjct: 62   KSKLDAQPELFIRLVPYKPSKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGA 121

Query: 508  DVSMIGQFGVGFYSAYLVAERVVVTSKHNDDEQYVWESQAGGSFTVTRDTTGEPLGRGTK 687
            DVSMIGQFGVGFYSAYLVAE+VVVT+KHNDDEQYVWESQAGGSFTVT DT GE LGRGTK
Sbjct: 122  DVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTLDTAGERLGRGTK 181

Query: 688  ITLYLKDDQLEYLEERRLKDLVKKHSEFISYPISLWTEKTTEKEISDDEDEDEKKDTEEG 867
            ITL+LKDDQLEYLEERRLKDLVKKHSEFISYPI LW+EKTTEKEISDDED+D   D  +G
Sbjct: 182  ITLFLKDDQLEYLEERRLKDLVKKHSEFISYPIYLWSEKTTEKEISDDEDDDI--DDSKG 239

Query: 868  KVEEIDEEKEEKEKKKKKIKEVSHEWNLINKQKPIWMRKPEEITKDEYAAFYKSLTNDWE 1047
            K +E D E+ + +KKKKK+ EVSHEW  INKQKPIW+RKPEEI+++EYA+FYKSLTNDWE
Sbjct: 240  KEKEGDIEEVKDKKKKKKVNEVSHEWVQINKQKPIWLRKPEEISREEYASFYKSLTNDWE 299

Query: 1048 EHLAVKHFSVEGQLEFKAVLFVPKRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPEW 1227
            +HLAVKHFSVEGQLEFKA+LFVP+RAPFDLFDTRKK+NNIKLYVRRVFIMDNCEELIPEW
Sbjct: 300  DHLAVKHFSVEGQLEFKAILFVPRRAPFDLFDTRKKMNNIKLYVRRVFIMDNCEELIPEW 359

Query: 1228 LSFVKGIVDSEDLPLNISRETLQQNKILKVIRKNLVKKCIELFFEIAENKEDYTKFYEAF 1407
            L FVKG+VDS+DLPLNISRE LQQNKILKVIRKNLVKKCIE+FFEIA+NKEDY KFYEAF
Sbjct: 360  LGFVKGVVDSDDLPLNISREMLQQNKILKVIRKNLVKKCIEMFFEIADNKEDYAKFYEAF 419

Query: 1408 SKNLKLGVHEDSTNRTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKA 1587
            SKNLKLG+HEDS NR KLA+LLRYHSTKSG+ELTSLKDYVTRMKEGQ ++YYITGES+KA
Sbjct: 420  SKNLKLGIHEDSQNRGKLADLLRYHSTKSGNELTSLKDYVTRMKEGQKEVYYITGESRKA 479

Query: 1588 VENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDDSEEEKKRK 1767
            VENSPFLEKLKKKGYEVL+MVDAIDEY++GQLKE++GKKLVSATKEGLKLDD ++ K+R 
Sbjct: 480  VENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDDDDAKER- 538

Query: 1768 EELKEKFEGLCKVIKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD 1947
               K  FE LCKVIKD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD
Sbjct: 539  ---KRSFEPLCKVIKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRD 595

Query: 1948 TSMGGYMSSKKTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDP 2127
            +SMG YMSSKKTMEINPEN IMEELRKRADAD NDKSV+DLV+LLFET+LLTSGFSLDDP
Sbjct: 596  SSMGAYMSSKKTMEINPENGIMEELRKRADADANDKSVRDLVLLLFETALLTSGFSLDDP 655

Query: 2128 NTFGTRIHRMLKLGLSIDEDD-EPAEADTDMPPLEEDAG-ESKMEEVD 2265
            NTF  RIHRMLKLGL+ID+DD   A+ D DMP L++ A  ESKMEEVD
Sbjct: 656  NTFAARIHRMLKLGLNIDDDDAAAADDDADMPALDDAAAEESKMEEVD 703
  9636.m03952|protein  Similar to heat shock protein 82
            Length = 614
            
 Score = 1185 bits (3032), Expect = 0.0
 Identities = 582/615 (94%), Positives = 607/615 (98%)
 Frame = +1

Query: 421  MTKSDLVNNLGTIARSGTKDFMEALAAGADVSMIGQFGVGFYSAYLVAERVVVTSKHNDD 600
            MTKSDLVNNLGTIARSGTK+FMEALAAGADVSMIGQFGVGFYSAYLVAERVVVT+KHNDD
Sbjct: 1    MTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDD 60

Query: 601  EQYVWESQAGGSFTVTRDTTGEPLGRGTKITLYLKDDQLEYLEERRLKDLVKKHSEFISY 780
            EQYVWESQAGGSFTVTRDT+GE LGRGTKITLYLKDDQLEYLEERRLKDL+KKHSEFISY
Sbjct: 61   EQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDDQLEYLEERRLKDLIKKHSEFISY 120

Query: 781  PISLWTEKTTEKEISDDEDEDEKKDTEEGKVEEIDEEKEEKEKKKKKIKEVSHEWNLINK 960
            PISLWTEKTTEKEISDDEDE+EKKD EEGKVE++DEEKEEKEKKKKKIKEVSHEW+L+NK
Sbjct: 121  PISLWTEKTTEKEISDDEDEEEKKDAEEGKVEDVDEEKEEKEKKKKKIKEVSHEWSLVNK 180

Query: 961  QKPIWMRKPEEITKDEYAAFYKSLTNDWEEHLAVKHFSVEGQLEFKAVLFVPKRAPFDLF 1140
            QKPIWMRKPEEITK+EYAAFYKSLTNDWEEHLAVKHFSVEGQLEFKAVLFVPKRAPFDLF
Sbjct: 181  QKPIWMRKPEEITKEEYAAFYKSLTNDWEEHLAVKHFSVEGQLEFKAVLFVPKRAPFDLF 240

Query: 1141 DTRKKLNNIKLYVRRVFIMDNCEELIPEWLSFVKGIVDSEDLPLNISRETLQQNKILKVI 1320
            DTRKKLNNIKLYVRRVFIMDNCEELIPEWLSFVKGIVDSEDLPLNISRE LQQNKILKVI
Sbjct: 241  DTRKKLNNIKLYVRRVFIMDNCEELIPEWLSFVKGIVDSEDLPLNISREMLQQNKILKVI 300

Query: 1321 RKNLVKKCIELFFEIAENKEDYTKFYEAFSKNLKLGVHEDSTNRTKLAELLRYHSTKSGD 1500
            RKNLVKKC+ELFFEIAENKEDY KFYEAFSKNLKLG+HEDSTNR K+AELLRYHSTKSGD
Sbjct: 301  RKNLVKKCVELFFEIAENKEDYNKFYEAFSKNLKLGIHEDSTNRNKIAELLRYHSTKSGD 360

Query: 1501 ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQ 1680
            ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEY++GQ
Sbjct: 361  ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQ 420

Query: 1681 LKEFEGKKLVSATKEGLKLDDSEEEKKRKEELKEKFEGLCKVIKDVLGDRVEKVIVSDRV 1860
            LKEFEGKKLVSATKEGLKLD+SE+EKKRKEELKEKFEGLCKVIK+VLGD+VEKV+VSDRV
Sbjct: 421  LKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKVIKEVLGDKVEKVVVSDRV 480

Query: 1861 VDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTMEINPENAIMEELRKRADA 2040
            VDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSKKTMEINPENAIMEELRKRADA
Sbjct: 481  VDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENAIMEELRKRADA 540

Query: 2041 DKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKLGLSIDEDDEPAEADTDMP 2220
            DKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG+RIHRMLKLGLSIDE DE AEADTDMP
Sbjct: 541  DKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKLGLSIDE-DETAEADTDMP 599

Query: 2221 PLEEDAGESKMEEVD 2265
            PLE+DAGESKMEEVD
Sbjct: 600  PLEDDAGESKMEEVD 614
  9634.m04916|protein  Hsp90 protein, putative
            Length = 818
            
 Score =  646 bits (1649), Expect = 0.0
 Identities = 345/724 (47%), Positives = 484/724 (66%), Gaps = 32/724 (4%)
 Frame = +1

Query: 88   HPLSLPSTLVDSARACVPGASAAGGAMASETETFAFQAEINQLLSLIINTFYSNKEIFLR 267
            H LS  S +V          S +   + S  E F FQAE+++L+ +IIN+ YSNK+IFLR
Sbjct: 79   HGLSTDSEVVQRE-----AESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLR 133

Query: 268  ELISNASDALDKIRFESLTDKSKLDA--QPELFIHIIPDKATNTLTLIDSGIGMTKSDLV 441
            ELISNASDALDKIRF +LTDK  L      +L I I  DK    L++ D GI        
Sbjct: 134  ELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIA------- 186

Query: 442  NNLGTIARSGTKDFMEALAAGADVSMIGQFGVGFYSAYLVAERVVVTSKHNDDEQYVWES 621
                         F+E +  G D+++IGQFGVGFYS YLVA+ V V SKHNDD+Q+VWES
Sbjct: 187  -------------FVEKMQTGGDLNLIGQFGVGFYSVYLVADYVEVISKHNDDKQHVWES 233

Query: 622  QAGGSFTVTRDTTGEPLGRGTKITLYLKDDQLEYLEERRLKDLVKKHSEFISYPISLWTE 801
            +A GSF ++ DT  EPLGRGT+I L+L+D+  EY+EE +LKDLVKK+SEFI++PI LW  
Sbjct: 234  KADGSFAISEDTWNEPLGRGTEIRLHLRDEAKEYVEEDKLKDLVKKYSEFINFPIYLWAT 293

Query: 802  KTTEKEISDDEDE-----DEKKDTEEGKVEEIDEEKEEKEKKKKKIKEVSHEWNLINKQK 966
            K  + E+  DEDE     +E++ + E   EE  EE EEK+ K K +KE + EW L+N  K
Sbjct: 294  KEVDVEVPADEDESSESSEEEESSPESTEEEETEESEEKKPKTKTVKETTTEWELLNDVK 353

Query: 967  PIWMRKPEEITKDEYAAFYKSLTNDW--EEHLAVKHFSVEGQLEFKAVLFVPKRAPFDLF 1140
             IW+R P+E+T++EY  FY SL  D+  ++ L+  HF+ EG +EFKA+LFVP +AP DL+
Sbjct: 354  AIWLRSPKEVTEEEYTKFYHSLAKDFGDDKPLSWSHFTAEGDVEFKALLFVPPKAPHDLY 413

Query: 1141 DTRKKLN--NIKLYVRRVFIMDNCEELIPEWLSFVKGIVDSEDLPLNISRETLQQNKILK 1314
            ++    N  N+KLYVRRVFI D  +EL+P++LSF+KG+VDS+ LPLN+SRE LQQ+  LK
Sbjct: 414  ESYYNSNKSNLKLYVRRVFISDEFDELLPKYLSFLKGLVDSDTLPLNVSREMLQQHSSLK 473

Query: 1315 VIRKNLVKKCIELFFEIAENKED---------------------YTKFYEAFSKNLKLGV 1431
             I+K L++K +++  ++AE   D                     Y KF+  F K++KLG+
Sbjct: 474  TIKKKLIRKALDMIRKLAEEDPDEYSNKDKTDEEKSAMEEKKGQYAKFWNEFGKSVKLGI 533

Query: 1432 HEDSTNRTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLE 1611
             ED+TNR +LA+LLR+ STKS  +L SL +Y++RMK GQ DI+YITG SK+ +E SPFLE
Sbjct: 534  IEDATNRNRLAKLLRFESTKSEGKLASLDEYISRMKPGQKDIFYITGSSKEQLEKSPFLE 593

Query: 1612 KLKKKGYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDDSEEEKKRKEELKEKFE 1791
            +L KK YEV+Y  D +DEY +  L ++E KK  + +KEGLKL    + K  KE  KE  +
Sbjct: 594  RLTKKNYEVIYFTDPVDEYLMQYLMDYEDKKFQNVSKEGLKLGKDSKLKDLKESFKELTD 653

Query: 1792 GLCKVIKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMS 1971
               K +     + V+ V +S+R+ D+PC +VT +YGW+ANME+IM++Q L D S   YM 
Sbjct: 654  WWKKALDT---ESVDSVKISNRLSDTPCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMR 710

Query: 1972 SKKTMEINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIH 2151
             K+ +EINP + I++ELR +   D   +S+K    L+++T+L+ SGF+L DP  F + I+
Sbjct: 711  GKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALMESGFNLPDPKDFASSIY 770

Query: 2152 RMLKLGLSIDEDDEPAEADTDMPPLEEDAGESKMEE 2259
            R ++  L +  D    E        EE+  E+++EE
Sbjct: 771  RSVQKSLDLSPDAAVEE--------EEEVEEAEVEE 798
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 162406474 Number of Sequences: 59712 Number of extensions: 5033342 Number of successful extensions: 64433 Number of sequences better than 1.0e-10: 20 Number of HSP's better than 0.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 64328 Number of HSP's gapped (non-prelim): 21 length of query: 855 length of database: 26,991,925 effective HSP length: 53 effective length of query: 801 effective length of database: 23,827,189 effective search space: 19085578389 effective search space used: 19085578389 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 162 (67.5 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG1208   Members:191            3pri:Y   1e-132     
 AAF23819.1       chlorophyll a/b binding protein precursor [Hordeum
vulgare]
         (1088 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9634.m02114|protein  chlorophyll a/b-binding protein precu...   462  e-130
 9635.m03689|protein  probable chlorophyll a/b-binding prot...   158  1e-38
 9636.m03389|protein  chlorophyll a/b-binding protein presu...   148  2e-35
 9637.m00977|protein  Chlorophyll A-B binding protein, puta...   147  3e-35
 9635.m03882|protein  LHCI-680, photosystem I antenna prote...   146  8e-35
 9639.m01284|protein  chlorophyll a/b-binding protein CP26 ...   146  8e-35
 9629.m05067|protein  Chlorophyll A-B binding protein, puta...   143  5e-34
 9637.m01516|protein  chlorophyll a/b-binding protein I pre...   141  2e-33
 9629.m03990|protein  Chlorophyll A-B binding protein, puta...   140  4e-33
 9631.m03807|protein  chlorophyll a/b binding protein            140  4e-33
 9637.m02343|protein  AY086461 PSI type II chlorophyll a/b-...   140  5e-33
 9635.m03724|protein  chlorophyll a-b binding protein of lh...   139  1e-32
 9630.m05194|protein  light-harvesting complex protein [imp...   139  1e-32
 9630.m00958|protein  chlorophyll a/b-binding protein type ...   138  2e-32
 9632.m03624|protein  chlorophyll a/b-binding apoprotein CP...    94  3e-19
 9630.m00957|protein  chlorophyll a/b-binding protein type ...    94  5e-19
 9639.m01283|protein  chlorophyll a/b-binding protein CP26 ...    72  2e-12

  9634.m02114|protein  chlorophyll a/b-binding protein precursor
           Length = 241
           
 Score =  462 bits (1176), Expect = e-130
 Identities = 218/241 (90%), Positives = 226/241 (93%)
 Frame = +2

Query: 83  SSSGLRSCSAVGVPSLLAPSSRSGRSGLPFCAYATTSGRVTMSAEWFPGQPRPAHLDGSS 262
           ++SGLRSCSAVGVPSLLAPSS   RS LP CAYATTSGRVTMSAEW PGQPRPAHLDGSS
Sbjct: 2   ATSGLRSCSAVGVPSLLAPSSN--RSRLPVCAYATTSGRVTMSAEWMPGQPRPAHLDGSS 59

Query: 263 PGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVPEALGLGNWVKAQEWAALP 442
           PGDFGFDPLGLATVPENFERFKESE+YHCRWAML VPGVLVPEALGLGNWV+AQEWAA P
Sbjct: 60  PGDFGFDPLGLATVPENFERFKESEVYHCRWAMLAVPGVLVPEALGLGNWVQAQEWAAEP 119

Query: 443 DGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQRTMEKDPEKKKYPGGAFDPLGFSKDPA 622
            GQATYLGNPVPWG LPTIL IEF+AIAFAE QRTMEKDPEKKKYPGGAFDPLGFSKDP 
Sbjct: 120 GGQATYLGNPVPWGTLPTILVIEFVAIAFAEHQRTMEKDPEKKKYPGGAFDPLGFSKDPV 179

Query: 623 KFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDIVIPRNI 802
           KFEE KLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLA+HL+DPWHNNIGDI+IPR I
Sbjct: 180 KFEEYKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLASHLSDPWHNNIGDIIIPRTI 239

Query: 803 Y 805
           Y
Sbjct: 240 Y 240
  9635.m03689|protein  probable chlorophyll a/b-binding protein -
           rice
           Length = 290
           
 Score =  158 bits (396), Expect = 1e-38
 Identities = 112/235 (47%), Positives = 141/235 (59%), Gaps = 54/235 (22%)
 Frame = +2

Query: 77  MASSSGLRSCSAVGVPSLLAPSSRSGRSGLPFC----------AYATTSGRVTMSAEWFP 226
           MASS    + + +G   L  P+ +SGR    F             A  S   T    WFP
Sbjct: 1   MASSVAAAASTFLGT-RLADPAPQSGRIVARFGFGGGKKAAAKKAARPSAPTTDRPLWFP 59

Query: 227 GQPRPAHLDGSSPGDFGFDPLGLATVPE-------------------------------- 310
           G   P +LDGS  GD+GFDP GL    E                                
Sbjct: 60  GAVAPDYLDGSLVGDYGFDPFGLGKPAEYLQFELDSLDQNLAKNNAGEIIGTRFETGEVK 119

Query: 311 -----------NFERFKESEIYHCRWAMLCVPGVLVPEALGLGNWVKAQEWAALPDGQAT 457
                        +RF+E E+ H RWAML   G L  E L    W  A +   L DG ++
Sbjct: 120 STPFQPYTEVFGLQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGK-VELVDG-SS 177

Query: 458 YLGNPVPWGNLPTILAIEFLAIAFAEQQRTMEKDPEKKKYPGGA-FDPLGFSKDPAKFEE 634
           YLG P+P+ ++ T++ IE L I + E QR  E DPEK+ YPGG+ FDPLG + DP K E 
Sbjct: 178 YLGQPLPF-SISTLIWIEVLVIGYIEFQRNAELDPEKRLYPGGSYFDPLGLASDPEKKER 236

Query: 635 LKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGD 781
           L+L EIK+ RLAM+AF+GF VQ +A  G GPL N ATHL+DP H  I D
Sbjct: 237 LQLAEIKHARLAMVAFLGFAVQAAA-TGKGPLNNWATHLSDPLHTTIFD 284
  9636.m03389|protein  chlorophyll a/b-binding protein presursor
           Length = 244
           
 Score =  148 bits (369), Expect = 2e-35
 Identities = 94/208 (45%), Positives = 121/208 (57%), Gaps = 19/208 (9%)
 Frame = +2

Query: 152 GRSGLPFCAYATTSGRVTMSA--EWFPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERF 325
           G+S        TT   V   A  EW PG P P +L+GS PGD GFDPLGLA  PEN   F
Sbjct: 25  GQSSTRLARAPTTRRNVRAEAKGEWLPGLPSPTYLNGSLPGDNGFDPLGLAEDPENLRWF 84

Query: 326 KESEIYHCRWAMLCVPGVLVPEALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILA 505
            ++E+ + RWAML V G+L+PE L     + A +W     G+ATY      + +  T+  
Sbjct: 85  VQAELVNGRWAMLGVAGMLLPEVLTKIGLIDAPQW--YDAGKATY------FASSSTLFV 136

Query: 506 IEFLAIAFAEQQR--------TMEKDPEKKK---------YPGGAFDPLGFSKDPAKFEE 634
           IEF+   + E +R         + +DP  K          YPG  F+PL F  +P    E
Sbjct: 137 IEFILFHYVEIRRWQDIKNPGCVNQDPIFKSYSLPPHECGYPGSVFNPLNF--EPTL--E 192

Query: 635 LKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNI 775
            K KE+ NGRLAMLAF+GF VQ +     GP +NL  HL+DPWHN I
Sbjct: 193 AKEKELANGRLAMLAFLGFLVQHNV-TQKGPFDNLLQHLSDPWHNTI 238
  9637.m00977|protein  Chlorophyll A-B binding protein, putative
           Length = 321
           
 Score =  147 bits (368), Expect = 3e-35
 Identities = 92/179 (51%), Positives = 115/179 (63%), Gaps = 21/179 (11%)
 Frame = +2

Query: 239 PAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVPEAL---GLGN 409
           PAHL G  PGD+GFD  GL   P  F  +   EI HCRWAML   GV+VPE L   G+ +
Sbjct: 118 PAHLTGEYPGDYGFDIAGLGRDPVAFANYFNFEILHCRWAMLAALGVVVPELLDLFGVVH 177

Query: 410 WVKAQEW----AALPDGQATYLGNP---VPWGNLPTILAI-EFLAIAFAEQQRTMEKD-- 559
           +V+   W    A L      YLG P   +  G    ++AI + L +   E  R    +  
Sbjct: 178 FVEPVWWKVGYAKLQGDTLDYLGIPGFRIAGGQGVIVIAICQALLMVGPEYARYCGIEAL 237

Query: 560 -------PEKKKYPGGA-FDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYP 715
                  P    YPGGA FDPLG SKDP  FE+LK+KEIKNGRLAM+A++GF + Q+A  
Sbjct: 238 EPLGLYLPGDINYPGGALFDPLGLSKDPVAFEDLKVKEIKNGRLAMVAWLGFYI-QAAVT 296

Query: 716 GTGPLENLATHLADPWHNNI 775
           G GP++NL  HL+DP HNNI
Sbjct: 297 GKGPIQNLVEHLSDPLHNNI 316
  9635.m03882|protein  LHCI-680, photosystem I antenna protein -
           barley
           Length = 263
           
 Score =  146 bits (364), Expect = 8e-35
 Identities = 101/243 (41%), Positives = 134/243 (54%), Gaps = 28/243 (11%)
 Frame = +2

Query: 68  AMAMASSSGLRSCSAVGVPSLLAPSSRSGRSGLPFCAYA-TTSGRVTMSAE--------W 220
           A+  ASSS     +  G     +    +GRSG      A ++S R + +          W
Sbjct: 2   ALVSASSSTTAVAALPGAARASSFLGGAGRSGRLLLRQAESSSARASFAVRAAAPDRPIW 61

Query: 221 FPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVPEALG 400
           FPG   P  LDGS PGDFGFDPLGL + PE+     ++E+ HCRWAML   G+ +PE L 
Sbjct: 62  FPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLT 121

Query: 401 LGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQR--------TMEK 556
               +    W     G+  Y      + +  T+  IE + I +AE +R         +  
Sbjct: 122 KIGILNTPSWYTA--GEQQY------FTDTTTLFIIELILIGWAEGRRWADIIKPGCVNT 173

Query: 557 DP---------EKKKYPGGA-FDPLGF-SKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQ 703
           DP             YPGG  FDPLG+ +  P K +EL+ KEIKNGRLAMLA +G    Q
Sbjct: 174 DPIFPNNKLTGTDVGYPGGLWFDPLGWGTGSPEKIKELRTKEIKNGRLAMLAVMGAWF-Q 232

Query: 704 SAYPGTGPLENLATHLADPWHNNIGDIVIPR 796
           + Y GTGP++NL  HLADP H  I     P+
Sbjct: 233 AEYTGTGPIDNLFAHLADPGHATIFQAFTPK 263
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83734179 Number of Sequences: 59712 Number of extensions: 3273829 Number of successful extensions: 96260 Number of sequences better than 1.0e-10: 34 Number of HSP's better than 0.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 11 Number of HSP's that attempted gapping in prelim test: 96186 Number of HSP's gapped (non-prelim): 27 length of query: 362 length of database: 26,991,925 effective HSP length: 51 effective length of query: 311 effective length of database: 23,946,613 effective search space: 7447396643 effective search space used: 7447396643 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG1210   Members:7              3pri:Y   8e-99      
 NP_568785.1      spermidine synthase [Arabidopsis thaliana]
ref|NP_851178.1| spermidine synthase [Arabidopsis thaliana]
         (1563 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9630.m01456|protein  spermidine synthase, putative              701  0.0
 9634.m03165|protein  spermidine synthase, putative              650  0.0
 9634.m03164|protein  spermidine synthase, putative              650  0.0
 9635.m02137|protein  spermidine synthase                        439  e-123
 9635.m02138|protein  spermidine synthase                        425  e-118
 9630.m01318|protein  Similar to AB076725 spermine synthase      101  4e-21

  9630.m01456|protein  spermidine synthase, putative
            Length = 397
            
 Score =  701 bits (1789), Expect = 0.0
 Identities = 343/385 (89%), Positives = 357/385 (92%), Gaps = 11/385 (2%)
 Frame = +3

Query: 243  MEGGDVRNG-LTGTSQTKGSGVDSPA----------KPLPPCCVKARAAAPESEAKCHAT 389
            MEGG  RNG  TG ++T GSG D+ A          KPLPPCCVKARAAAPESEAKCHAT
Sbjct: 1    MEGGGARNGSTTGAARTGGSGGDAAAGGGGGSAGNGKPLPPCCVKARAAAPESEAKCHAT 60

Query: 390  VVSGWFTETHSRCGKASKLQYYNNPMWPGETHSLKVEKILYQGKSPYQEVLIFESLTYGK 569
            VVSGWFTE  SR GK SK+QYYNNPMWPGE HSLKVEKILYQGKSPYQEVL+FES TYGK
Sbjct: 61   VVSGWFTEPRSRGGKTSKVQYYNNPMWPGEAHSLKVEKILYQGKSPYQEVLVFESSTYGK 120

Query: 570  VLVLDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREIARHGSVESID 749
            VLVLDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREI RHGSVESID
Sbjct: 121  VLVLDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREICRHGSVESID 180

Query: 750  ICEIDQLVIDVCKDFFPDLSVGFKDPRVRLHVGDAVEFLRNTPEGTYDAIIVDSSDPIGP 929
            ICEIDQLVIDVCKDFFPDLSVGFKDPRVRLHVGDAVEFLRN PEGTYDAIIVDSSDPIGP
Sbjct: 181  ICEIDQLVIDVCKDFFPDLSVGFKDPRVRLHVGDAVEFLRNAPEGTYDAIIVDSSDPIGP 240

Query: 930  AQELVEKPFFETIARALRPGGVLCNQAESMWLHTHLIQDMLSICCETFKGSVHYAWTSVP 1109
            AQELVEKPFF+TIARALRPGGVLCNQAESMWLHTHLIQDMLSIC ETFKGSVHYAWTSVP
Sbjct: 241  AQELVEKPFFDTIARALRPGGVLCNQAESMWLHTHLIQDMLSICRETFKGSVHYAWTSVP 300

Query: 1110 TYPSGAIGFLLCAKEGPPVNFLAPINPIEKLEGAMTAGRDIRFYNTEMHKAAFVLPTFAK 1289
            TYPSG IGFLLCAKEGPPVNFL P NPIEKLEGAM AGRDIRFYN+EMH+AAFVLPTFA+
Sbjct: 301  TYPSGVIGFLLCAKEGPPVNFLTPANPIEKLEGAMEAGRDIRFYNSEMHRAAFVLPTFAR 360

Query: 1290 RELETYGGSTRRAQQEETSAEPAKVAIVPHSEILTA 1397
            RELE Y  +  R QQEET+AEP K+ I+P+SEILTA
Sbjct: 361  RELEAYCTTVEREQQEETTAEPLKMNIMPNSEILTA 396
  9634.m03165|protein  spermidine synthase, putative
            Length = 387
            
 Score =  650 bits (1658), Expect = 0.0
 Identities = 307/385 (79%), Positives = 342/385 (88%), Gaps = 1/385 (0%)
 Frame = +3

Query: 243  MEGGDVRNGLTGTSQTKGSGVDSPAKPLPPCCVKARAAAPESEAKCHATVVSGWFTETHS 422
            MEGG  ++G    +QT+GSG D   KPLPPCC+KA+AAA ESEAKCHATVVSGWFTE  S
Sbjct: 1    MEGGGAKDGSAAAAQTRGSGDDGSHKPLPPCCLKAKAAAAESEAKCHATVVSGWFTEPRS 60

Query: 423  RCGKASKLQYYNNPMWPGETHSLKVEKILYQGKSPYQEVLIFESLTYGKVLVLDGIVQLT 602
              GK SK+QY+NNPMWPGE HSLKVE ILYQGKSPYQE+L+FES TYG VLVLDGIVQLT
Sbjct: 61   HSGKTSKVQYFNNPMWPGEAHSLKVENILYQGKSPYQEILVFESSTYGNVLVLDGIVQLT 120

Query: 603  DKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREIARHGSVESIDICEIDQLVIDV 782
            +KDECAYQEM+THLPLCSIPSPK VLV+GGGDGGVLREIARH SVE+IDICEIDQLVIDV
Sbjct: 121  EKDECAYQEMVTHLPLCSIPSPKSVLVVGGGDGGVLREIARHASVENIDICEIDQLVIDV 180

Query: 783  CKDFFPDLSVGFKDPRVRLHVGDAVEFLRNTPEGTYDAIIVDSSDPIGPAQELVEKPFFE 962
            CKDFFP LSVGFKDPRV+LHVGDAV+FLRN PEG YDAIIVDSSDPIGPAQELVEKPFF+
Sbjct: 181  CKDFFPQLSVGFKDPRVQLHVGDAVDFLRNAPEGKYDAIIVDSSDPIGPAQELVEKPFFQ 240

Query: 963  TIARALRPGGVLCNQAESMWLHTHLIQDMLSICCETFKGSVHYAWTSVPTYPSGAIGFLL 1142
            TIARAL+PGGVLCNQAESMWLHTHLIQDMLSIC ETFKG+VHYAWTSVPTYPSG IGFLL
Sbjct: 241  TIARALKPGGVLCNQAESMWLHTHLIQDMLSICRETFKGAVHYAWTSVPTYPSGVIGFLL 300

Query: 1143 CAKEGPPVNFLAPINPIEKLEGAMTAGRDIRFYNTEMHKAAFVLPTFAKRELETYGGSTR 1322
            CAKEGP VNFL+P+NPIEKLEGAM AGR+IRFYN+E+H+AAFVLPTF +RELE++     
Sbjct: 301  CAKEGPAVNFLSPVNPIEKLEGAMEAGREIRFYNSEVHRAAFVLPTFVRRELESHNTCAE 360

Query: 1323 RAQQE-ETSAEPAKVAIVPHSEILTA 1397
            + + E +  A+P K+ I+P+S I TA
Sbjct: 361  KDKSETKPVAKPKKMKIMPNSAIPTA 386
  9634.m03164|protein  spermidine synthase, putative
            Length = 387
            
 Score =  650 bits (1658), Expect = 0.0
 Identities = 307/385 (79%), Positives = 342/385 (88%), Gaps = 1/385 (0%)
 Frame = +3

Query: 243  MEGGDVRNGLTGTSQTKGSGVDSPAKPLPPCCVKARAAAPESEAKCHATVVSGWFTETHS 422
            MEGG  ++G    +QT+GSG D   KPLPPCC+KA+AAA ESEAKCHATVVSGWFTE  S
Sbjct: 1    MEGGGAKDGSAAAAQTRGSGDDGSHKPLPPCCLKAKAAAAESEAKCHATVVSGWFTEPRS 60

Query: 423  RCGKASKLQYYNNPMWPGETHSLKVEKILYQGKSPYQEVLIFESLTYGKVLVLDGIVQLT 602
              GK SK+QY+NNPMWPGE HSLKVE ILYQGKSPYQE+L+FES TYG VLVLDGIVQLT
Sbjct: 61   HSGKTSKVQYFNNPMWPGEAHSLKVENILYQGKSPYQEILVFESSTYGNVLVLDGIVQLT 120

Query: 603  DKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREIARHGSVESIDICEIDQLVIDV 782
            +KDECAYQEM+THLPLCSIPSPK VLV+GGGDGGVLREIARH SVE+IDICEIDQLVIDV
Sbjct: 121  EKDECAYQEMVTHLPLCSIPSPKSVLVVGGGDGGVLREIARHASVENIDICEIDQLVIDV 180

Query: 783  CKDFFPDLSVGFKDPRVRLHVGDAVEFLRNTPEGTYDAIIVDSSDPIGPAQELVEKPFFE 962
            CKDFFP LSVGFKDPRV+LHVGDAV+FLRN PEG YDAIIVDSSDPIGPAQELVEKPFF+
Sbjct: 181  CKDFFPQLSVGFKDPRVQLHVGDAVDFLRNAPEGKYDAIIVDSSDPIGPAQELVEKPFFQ 240

Query: 963  TIARALRPGGVLCNQAESMWLHTHLIQDMLSICCETFKGSVHYAWTSVPTYPSGAIGFLL 1142
            TIARAL+PGGVLCNQAESMWLHTHLIQDMLSIC ETFKG+VHYAWTSVPTYPSG IGFLL
Sbjct: 241  TIARALKPGGVLCNQAESMWLHTHLIQDMLSICRETFKGAVHYAWTSVPTYPSGVIGFLL 300

Query: 1143 CAKEGPPVNFLAPINPIEKLEGAMTAGRDIRFYNTEMHKAAFVLPTFAKRELETYGGSTR 1322
            CAKEGP VNFL+P+NPIEKLEGAM AGR+IRFYN+E+H+AAFVLPTF +RELE++     
Sbjct: 301  CAKEGPAVNFLSPVNPIEKLEGAMEAGREIRFYNSEVHRAAFVLPTFVRRELESHNTCAE 360

Query: 1323 RAQQE-ETSAEPAKVAIVPHSEILTA 1397
            + + E +  A+P K+ I+P+S I TA
Sbjct: 361  KDKSETKPVAKPKKMKIMPNSAIPTA 386
  9635.m02137|protein  spermidine synthase
            Length = 323
            
 Score =  439 bits (1117), Expect = e-123
 Identities = 204/314 (64%), Positives = 252/314 (79%)
 Frame = +3

Query: 351  AAAPESEAKCHATVVSGWFTETHSRCGKASKLQYYNNPMWPGETHSLKVEKILYQGKSPY 530
            AAA   E    + V+ GWF+E               +PMWPGE HSLKVEK+L+QGKS Y
Sbjct: 17   AAAGAGEQAGISAVIPGWFSEI--------------SPMWPGEAHSLKVEKVLFQGKSDY 62

Query: 531  QEVLIFESLTYGKVLVLDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVL 710
            Q V++F+S TYGKVLVLDG++Q+T++DECAYQEMITHLPLCSI  PKKVLVIGGGDGGVL
Sbjct: 63   QNVMVFQSSTYGKVLVLDGVIQVTERDECAYQEMITHLPLCSIKDPKKVLVIGGGDGGVL 122

Query: 711  REIARHGSVESIDICEIDQLVIDVCKDFFPDLSVGFKDPRVRLHVGDAVEFLRNTPEGTY 890
            RE++RH SVE IDICEID++V+DV K FFP L+VGF+DPRV LH+GD V FL+N PEGTY
Sbjct: 123  REVSRHSSVEQIDICEIDKMVVDVSKQFFPHLAVGFEDPRVSLHIGDGVAFLKNAPEGTY 182

Query: 891  DAIIVDSSDPIGPAQELVEKPFFETIARALRPGGVLCNQAESMWLHTHLIQDMLSICCET 1070
            DA+IVDSSDPIGPAQEL EKPFF+++ARALRPGGV+C QAES+WLH H+I+D+++ C + 
Sbjct: 183  DAVIVDSSDPIGPAQELFEKPFFQSVARALRPGGVVCTQAESIWLHMHIIEDIVANCRQV 242

Query: 1071 FKGSVHYAWTSVPTYPSGAIGFLLCAKEGPPVNFLAPINPIEKLEGAMTAGRDIRFYNTE 1250
            FKGSV+YAWT+VPTYPSG IGF+LC+ EGP V+F  PI  IE  E +  +   ++FYN+E
Sbjct: 243  FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPTVDFQHPIFNIEDNEFSTKSKGPLKFYNSE 302

Query: 1251 MHKAAFVLPTFAKR 1292
            +H A+F LP+FAKR
Sbjct: 303  IHSASFCLPSFAKR 316
  9635.m02138|protein  spermidine synthase
            Length = 319
            
 Score =  425 bits (1080), Expect = e-118
 Identities = 200/314 (63%), Positives = 248/314 (78%)
 Frame = +3

Query: 351  AAAPESEAKCHATVVSGWFTETHSRCGKASKLQYYNNPMWPGETHSLKVEKILYQGKSPY 530
            AAA   E    + V+ GWF+E               +PMWPGE HSLKVEK+L+QGKS Y
Sbjct: 17   AAAGAGEQAGISAVIPGWFSEI--------------SPMWPGEAHSLKVEKVLFQGKSDY 62

Query: 531  QEVLIFESLTYGKVLVLDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVL 710
            Q V++F+S TYGKVLVLDG++Q+T++DECAYQEMITHLPLCSI  PKKVLVIGGGDGGVL
Sbjct: 63   QNVMVFQSSTYGKVLVLDGVIQVTERDECAYQEMITHLPLCSIKDPKKVLVIGGGDGGVL 122

Query: 711  REIARHGSVESIDICEIDQLVIDVCKDFFPDLSVGFKDPRVRLHVGDAVEFLRNTPEGTY 890
            RE++RH SVE IDICEID++V+DV K FFP L+VGF+DPRV LH+GD V FL+N PEGTY
Sbjct: 123  REVSRHSSVEQIDICEIDKMVVDVSKQFFPHLAVGFEDPRVSLHIGDGVAFLKNAPEGTY 182

Query: 891  DAIIVDSSDPIGPAQELVEKPFFETIARALRPGGVLCNQAESMWLHTHLIQDMLSICCET 1070
            DA+IVDSSDPI    EL EKPFF+++ARALRPGGV+C QAES+WLH H+I+D+++ C + 
Sbjct: 183  DAVIVDSSDPI----ELFEKPFFQSVARALRPGGVVCTQAESIWLHMHIIEDIVANCRQV 238

Query: 1071 FKGSVHYAWTSVPTYPSGAIGFLLCAKEGPPVNFLAPINPIEKLEGAMTAGRDIRFYNTE 1250
            FKGSV+YAWT+VPTYPSG IGF+LC+ EGP V+F  PI  IE  E +  +   ++FYN+E
Sbjct: 239  FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPTVDFQHPIFNIEDNEFSTKSKGPLKFYNSE 298

Query: 1251 MHKAAFVLPTFAKR 1292
            +H A+F LP+FAKR
Sbjct: 299  IHSASFCLPSFAKR 312
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 104572508 Number of Sequences: 59712 Number of extensions: 3303331 Number of successful extensions: 53916 Number of sequences better than 1.0e-10: 12 Number of HSP's better than 0.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 53900 Number of HSP's gapped (non-prelim): 8 length of query: 521 length of database: 26,991,925 effective HSP length: 52 effective length of query: 468 effective length of database: 23,886,901 effective search space: 11179069668 effective search space used: 11179069668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG1216   Members:65             3pri:Y   5e-86      
 P42767           Aquaporin PIP-type gb|AAA86991.1| aquaporin
         (1255 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9632.m01476|protein  MIP family channel proteins, putative      518  e-147
 9635.m02571|protein  MIP family channel proteins, putative      433  e-121
 9630.m04003|protein  plasma membrane intrinsic protein BPW...   432  e-121
 9632.m04226|protein  MIP family channel proteins, putative      419  e-117
 9635.m02567|protein  MIP family channel proteins, putative      415  e-116
 9635.m02564|protein  MIP family channel proteins, putative      411  e-114
 9637.m03122|protein  MIP family channel proteins, putative      407  e-113
 9630.m04319|protein  aquaporin                                  405  e-112
 9630.m05755|protein  water channel protein RWC3                 382  e-106
 9630.m04002|protein  plasma membrane intrinsic protein BPW...   378  e-104
 9632.m04558|protein  MIP family channel proteins, putative      332  e-102
 9631.m06380|protein  putative plasma membrane intrinsic pr...   352  7e-97
 9638.m02985|protein  putative aquaporin                         324  2e-88
 9630.m04001|protein  plasma membrane intrinsic protein BPW...   295  1e-79
 9635.m02565|protein  Major intrinsic protein, putative          270  4e-72
 9629.m07384|protein  MIP family channel proteins                144  4e-34
 9634.m02259|protein  delta-type tonoplast intrinsic protein     143  6e-34
 9630.m04256|protein  MIP family channel proteins                131  3e-30
 9638.m03093|protein  putative beta-tonoplast intrinsic pro...   130  5e-30
 9632.m04280|protein  MIP family channel proteins, putative      126  7e-29

  9632.m01476|protein  MIP family channel proteins, putative
           Length = 282
           
 Score =  518 bits (1321), Expect = e-147
 Identities = 251/284 (88%), Positives = 268/284 (93%)
 Frame = +3

Query: 30  MAKEVSEEPEHAAPARKDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATV 209
           M+KEVSEEPEH  P  KDY+DPPPAPLFD+GELR+WSFYRALIAEF+ATLLFLYITVATV
Sbjct: 1   MSKEVSEEPEHVRP--KDYTDPPPAPLFDVGELRLWSFYRALIAEFIATLLFLYITVATV 58

Query: 210 IGYKVQSAADPCAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKVSLL 389
           IGYKVQS+AD C GVG LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLLLARKVS++
Sbjct: 59  IGYKVQSSADQCGGVGTLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKVSVI 118

Query: 390 RAVMYIVAQCAGGIVGAGIVKGIMKDAYQANGGGANMVASGFSRGTALGAEIVGTFVLVY 569
           RAVMYIVAQC GGIVG GIVKGIMK  Y ANGGGANMVASG+S GTALGAEI+GTFVLVY
Sbjct: 119 RAVMYIVAQCLGGIVGVGIVKGIMKHQYNANGGGANMVASGYSTGTALGAEIIGTFVLVY 178

Query: 570 TVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKKA 749
           TVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS+GAAVIYN+K 
Sbjct: 179 TVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVIYNQKK 238

Query: 750 AWDNHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSSRSN 881
           AWD+HWIFW GPF+GALAAAAYHQYILRAAAIKALGSFRS+ SN
Sbjct: 239 AWDDHWIFWAGPFIGALAAAAYHQYILRAAAIKALGSFRSNPSN 282
  9635.m02571|protein  MIP family channel proteins, putative
           Length = 290
           
 Score =  433 bits (1101), Expect = e-121
 Identities = 211/267 (79%), Positives = 231/267 (86%), Gaps = 6/267 (2%)
 Frame = +3

Query: 72  ARKDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQSAADP--- 242
           A KDY+DPPPAPL D  EL  WS YRA+IAEF+ATLLFLYITVATVIGYK Q+ A     
Sbjct: 17  AAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDASASGA 76

Query: 243 ---CAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKVSLLRAVMYIVA 413
              C GVGVLGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKVSL+RA++YIVA
Sbjct: 77  DAACGGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYIVA 136

Query: 414 QCAGGIVGAGIVKGIMKDAYQANGGGANMVASGFSRGTALGAEIVGTFVLVYTVFSATDP 593
           QC G I G G+VK      +   GGGAN +A+G+S+GT L AEI+GTFVLVYTVFSATDP
Sbjct: 137 QCLGAICGVGLVKAFQSAYFNRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDP 196

Query: 594 KRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKKAAWDNHWIF 773
           KR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS+GAAVI+N + AW NHWIF
Sbjct: 197 KRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVIFNNEKAWHNHWIF 256

Query: 774 WVGPFVGALAAAAYHQYILRAAAIKALGSFRSS 872
           WVGPFVGA  AA YHQYILRA AIKALGSFRS+
Sbjct: 257 WVGPFVGAAIAAFYHQYILRAGAIKALGSFRSN 289
  9630.m04003|protein  plasma membrane intrinsic protein BPW1 -
           barley
           Length = 288
           
 Score =  432 bits (1099), Expect = e-121
 Identities = 212/281 (75%), Positives = 240/281 (84%), Gaps = 7/281 (2%)
 Frame = +3

Query: 30  MAKEV-SEEPEHAAPARKDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVAT 206
           MAK++ +  PE    + KDY+DPPPAPL D+ EL  WS YRA+IAEF+ATLLFLYITVAT
Sbjct: 1   MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT 60

Query: 207 VIGYKVQSAAD------PCAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLL 368
           VIGYK QS A        C+GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL L
Sbjct: 61  VIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 120

Query: 369 ARKVSLLRAVMYIVAQCAGGIVGAGIVKGIMKDAYQANGGGANMVASGFSRGTALGAEIV 548
           ARKVSL+RAV+YI+AQC G I G G+VKG     Y   GGGAN ++ G+S+GT LGAEI+
Sbjct: 121 ARKVSLIRAVLYIIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLGAEII 180

Query: 549 GTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAA 728
           GTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSLG A
Sbjct: 181 GTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGTA 240

Query: 729 VIYNKKAAWDNHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSS 872
           VIYNK  AWD+ WIFWVGP +GA  AAAYHQY+LRA+A K LGS+RS+
Sbjct: 241 VIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSN 287
  9632.m04226|protein  MIP family channel proteins, putative
           Length = 290
           
 Score =  419 bits (1065), Expect = e-117
 Identities = 217/282 (76%), Positives = 238/282 (83%), Gaps = 12/282 (4%)
 Frame = +3

Query: 30  MAKEVSEEPEHAAPAR------KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLY 191
           MAK++    E AA A       KDYSDPPPAPL D  EL  WS YRA+IAEFVATLLFLY
Sbjct: 1   MAKDI----EAAAAAEGGEYMAKDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLY 56

Query: 192 ITVATVIGYKVQS-----AADP-CAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVT 353
           ITVATVIGYK QS     AAD  C+GVG+LGIAWAFGGMIF+LVYCTAG+SGGHINPAVT
Sbjct: 57  ITVATVIGYKHQSDPGANAADAACSGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVT 116

Query: 354 FGLLLARKVSLLRAVMYIVAQCAGGIVGAGIVKGIMKDAYQANGGGANMVASGFSRGTAL 533
           FGL LARKVSL+RAV+YIVAQ  G I G G+VKG     Y   GGGAN ++ G+S+GT L
Sbjct: 117 FGLFLARKVSLVRAVLYIVAQSLGAICGVGLVKGFQSAFYVRYGGGANELSDGYSKGTGL 176

Query: 534 GAEIVGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR 713
            AEI+GTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR
Sbjct: 177 AAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR 236

Query: 714 SLGAAVIYNKKAAWDNHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSSR 875
           SLGAAVIYN+  AW +HWIFWVGP +GA  AAAYHQY+LRA+A K LGS  S R
Sbjct: 237 SLGAAVIYNQHKAWHDHWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSSSSFR 289
  9635.m02567|protein  MIP family channel proteins, putative
           Length = 283
           
 Score =  415 bits (1056), Expect = e-116
 Identities = 202/277 (72%), Positives = 230/277 (82%), Gaps = 6/277 (2%)
 Frame = +3

Query: 42  VSEEPEHAAPARKDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYK 221
           + +E +  A   +DY DPPPAPL D+ EL  WS YRA+IAEFVATLLFLY+TVATVIGYK
Sbjct: 1   MGKEADVEAGGVRDYEDPPPAPLVDIDELGRWSLYRAVIAEFVATLLFLYVTVATVIGYK 60

Query: 222 VQSAADP------CAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKVS 383
            Q+ A        C GVGVLGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKVS
Sbjct: 61  HQTDASASGDDAACGGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVS 120

Query: 384 LLRAVMYIVAQCAGGIVGAGIVKGIMKDAYQANGGGANMVASGFSRGTALGAEIVGTFVL 563
           L+RA++YIVAQC G + G  +VKG     Y   GGGAN +A+G+S+GT L AEI+GTFVL
Sbjct: 121 LVRAILYIVAQCLGAVCGVALVKGFQSSFYDRYGGGANELAAGYSKGTGLAAEIIGTFVL 180

Query: 564 VYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNK 743
           VYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSLGAAV+YN 
Sbjct: 181 VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVVYNN 240

Query: 744 KAAWDNHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSS 872
             AW + WIFWVGPF+GA  AA YHQ +LRA+A +  GSFRS+
Sbjct: 241 SKAWSDQWIFWVGPFIGAAIAALYHQIVLRASA-RGYGSFRSN 282
Database: all.pep Posted date: Nov 22, 2004 11:49 AM Number of letters in database: 26,991,925 Number of sequences in database: 59,712 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97166940 Number of Sequences: 59712 Number of extensions: 3659338 Number of successful extensions: 87837 Number of sequences better than 1.0e-10: 71 Number of HSP's better than 0.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 34 Number of HSP's that attempted gapping in prelim test: 86694 Number of HSP's gapped (non-prelim): 257 length of query: 418 length of database: 26,991,925 effective HSP length: 52 effective length of query: 365 effective length of database: 23,886,901 effective search space: 8718718865 effective search space used: 8718718865 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)
BLASTX 2.0.11 [Jan-20-2000]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CONTIG1222   Members:89             3pri:Y   1e-129     
 AAK26758.1       plasma membrane integral protein ZmPIP2-1 [Zea mays]
         (1259 letters)

Database: all.pep
           59,712 sequences; 26,991,925 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

 9635.m02571|protein  MIP family channel proteins, putative      537  e-152
 9630.m04003|protein  plasma membrane intrinsic protein BPW...   504  e-142
 9632.m04226|protein  MIP family channel proteins, putative      490  e-138
 9635.m02567|protein  MIP family channel proteins, putative      482  e-136
 9635.m02564|protein  MIP family channel proteins, putative      480  e-135
 9630.m04002|protein  plasma membrane intrinsic protein BPW...   444  e-124
 9632.m01476|protein  MIP family channel proteins, putative